SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Bombardment : 15666 dps, 4664 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
15666.1 15666.1 30.0 / 0.191% 1868.9 / 11.9% 7.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2133.3 2023.1 Mana 0.00% 51.8 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Bombardment 15666
Arcane Barrage 7631 48.7% 58.7 5.11sec 38809 32312 Direct 293.2 6538 13206 7774 18.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.71 293.16 0.00 0.00 1.2011 0.0000 2278524.03 2278524.03 0.00% 32312.16 32312.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.46% 238.80 177 306 6538.34 2560 39762 6535.83 5806 7139 1561373 1561373 0.00%
crit 18.54% 54.36 31 86 13206.21 5121 79524 13197.09 10063 18009 717151 717151 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:58.72
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 5928 37.8% 160.3 1.84sec 11035 9210 Direct 801.4 1847 3784 2207 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 160.29 801.44 0.00 0.00 1.1981 0.0000 1768727.36 1768727.36 0.00% 9210.30 9210.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 652.46 508 795 1847.35 1391 3757 1848.41 1775 1932 1205276 1205276 0.00%
crit 18.59% 148.98 95 209 3783.53 2782 7514 3783.71 3404 4179 563451 563451 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:160.31
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1120) 0.0% (7.1%) 13.6 22.63sec 24599 20407

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.58 0.00 0.00 0.00 1.2054 0.0000 0.00 0.00 0.00% 20407.46 20407.46

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.59
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1120 7.1% 67.8 22.63sec 4925 0 Direct 67.8 4128 8407 4926 18.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.84 67.84 0.00 0.00 0.0000 0.0000 334131.31 334131.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 55.19 34 74 4127.77 2749 7425 4133.28 3616 4546 227868 227868 0.00%
crit 18.65% 12.65 3 25 8406.74 5498 14849 8388.92 5938 11104 106263 106263 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.70sec 1375 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.70sec 1375 0 Direct 14.7 1137 2274 1374 20.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.72 14.72 0.00 0.00 0.0000 0.0000 20229.68 20229.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.10% 11.64 5 21 1136.97 1117 1184 1136.79 1117 1184 13235 13235 0.00%
crit 20.90% 3.08 0 11 2273.72 2233 2367 2207.09 0 2367 6994 6994 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 38 0.2% 20.6 14.15sec 553 0 Direct 20.6 465 929 553 19.1%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.55 20.55 0.00 0.00 0.0000 0.0000 11370.73 11370.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.92% 16.63 8 30 464.59 453 481 464.56 453 477 7726 7726 0.00%
crit 19.08% 3.92 0 15 929.07 907 961 906.73 0 961 3644 3644 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1201 17.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1200.85 1200.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 0.83 0 1 1023.69 1024 1024 846.54 0 1024 847 847 0.00%
crit 17.31% 0.17 0 1 2047.39 2047 2047 354.32 0 2047 354 354 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (15) 0.0% (0.1%) 1.0 0.00sec 4516 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 113  / 15 0.1% 93.0 1.25sec 49 38 Direct 93.0 40 82 49 19.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2644 0.0000 4515.62 4515.62 0.00% 38.40 38.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.32% 74.70 62 84 40.45 30 51 40.45 39 42 3022 3022 0.00%
crit 19.68% 18.30 9 31 81.64 59 101 81.68 70 93 1494 1494 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (861) 0.0% (5.5%) 6.3 50.81sec 40604 32189

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 0.00 0.00 0.00 1.2615 0.0000 0.00 0.00 0.00% 32189.02 32189.02

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.33
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 861 5.5% 6.3 50.68sec 40604 0 Direct 31.4 8160 0 8160 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 31.43 0.00 0.00 0.0000 0.0000 256160.25 256160.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.43 25 40 8159.97 2304 49109 8157.70 5975 10796 256160 256160 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:25844.01
  • base_dd_max:25844.01
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Bombardment
Arcane Power 2.9 124.92sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.90
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 249.60sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.90
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 174.18sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 6.87 0.00 4.1511 0.6969 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bombardment
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.15
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bombardment
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bombardment
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.2 49.07sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.2144 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.18
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 122.96sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bombardment
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.4 188.6 5.0sec 1.2sec 3.7sec 74.62% 0.00% 29.1 (30.1) 0.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.8s
  • trigger_min/max:0.0s / 6.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.2s

Stack Uptimes

  • arcane_charge_1:19.58%
  • arcane_charge_2:17.14%
  • arcane_charge_3:16.49%
  • arcane_charge_4:21.41%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 124.9sec 124.9sec 14.6sec 14.27% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 129.3s
  • trigger_min/max:120.2s / 129.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.27%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 249.6sec 249.6sec 11.6sec 7.40% 17.82% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:248.7s / 257.1s
  • trigger_min/max:248.7s / 257.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.40%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.4 0.2 11.4sec 11.3sec 1.9sec 16.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.95%
  • clearcasting_2:0.20%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.5sec 60.5sec 28.7sec 52.09% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 63.2s
  • trigger_min/max:60.0s / 63.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.96%
  • crimson_chorus_2:17.36%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 171.3sec 171.3sec 4.1sec 1.61% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:96.3s / 259.2s
  • trigger_min/max:96.3s / 259.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.2s

Stack Uptimes

  • evocation_1:1.61%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 124.9sec 124.9sec 14.6sec 14.27% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:120.2s / 129.3s
  • trigger_min/max:120.2s / 129.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.27%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.1 0.0 34.2sec 34.2sec 11.8sec 35.76% 0.00% 0.0 (0.0) 8.8

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 51.0s
  • trigger_min/max:15.1s / 51.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.76%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.85% 0.73% 5.30% 0.9s 0.0s 4.5s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation142.8936.285352.293210.945132.638352.293
Rune of Power5.0020.39620.76931.96218.52741.230
Touch of the Magi3.8060.00018.65125.03116.98239.659
Arcane Power3.6140.2319.28010.5556.30518.341
Arcane Barrage2.6810.0037.995158.645126.207193.053
Arcane Orb2.5980.0649.66035.57827.24145.553

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Bombardment
mana_regen Mana 477.44 381116.60 63.07% 798.26 8932.16 2.29%
Evocation Mana 52.60 57239.65 9.47% 1088.14 0.00 0.00%
Mana Gem Mana 2.77 18086.30 2.99% 6539.43 0.00 0.00%
Arcane Barrage Mana 58.72 147822.42 24.46% 2517.53 5768.69 3.76%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 64394.3 2023.06 2133.27 14702.6 32477.2 302.2 65394.3
Usage Type Count Total Avg RPE APR
Bombardment
arcane_explosion Mana 160.3 614404.6 3832.6 3833.2 2.9
arcane_orb Mana 13.6 6088.3 448.0 448.2 54.9
touch_of_the_magi Mana 6.3 15759.9 2500.0 2498.1 16.3

Statistics & Data Analysis

Fight Length
Bombardment Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Bombardment Damage Per Second
Count 1017
Mean 15666.05
Minimum 14391.69
Maximum 17033.96
Spread ( max - min ) 2642.27
Range [ ( max - min ) / 2 * 100% ] 8.43%
Standard Deviation 487.6524
5th Percentile 14861.37
95th Percentile 16469.39
( 95th Percentile - 5th Percentile ) 1608.02
Mean Distribution
Standard Deviation 15.2915
95.00% Confidence Interval ( 15636.08 - 15696.03 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3723
0.1 Scale Factor Error with Delta=300 2031
0.05 Scale Factor Error with Delta=300 8121
0.01 Scale Factor Error with Delta=300 203004
Priority Target DPS
Bombardment Priority Target Damage Per Second
Count 1017
Mean 4663.64
Minimum 4015.01
Maximum 5419.41
Spread ( max - min ) 1404.40
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 215.2742
5th Percentile 4326.39
95th Percentile 5034.11
( 95th Percentile - 5th Percentile ) 707.72
Mean Distribution
Standard Deviation 6.7504
95.00% Confidence Interval ( 4650.40 - 4676.87 )
Normalized 95.00% Confidence Interval ( 99.72% - 100.28% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 82
0.1% Error 8186
0.1 Scale Factor Error with Delta=300 396
0.05 Scale Factor Error with Delta=300 1583
0.01 Scale Factor Error with Delta=300 39562
DPS(e)
Bombardment Damage Per Second (Effective)
Count 1017
Mean 15666.05
Minimum 14391.69
Maximum 17033.96
Spread ( max - min ) 2642.27
Range [ ( max - min ) / 2 * 100% ] 8.43%
Damage
Bombardment Damage
Count 1017
Mean 4670344.21
Minimum 3548910.58
Maximum 5549876.71
Spread ( max - min ) 2000966.13
Range [ ( max - min ) / 2 * 100% ] 21.42%
DTPS
Bombardment Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Bombardment Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Bombardment Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Bombardment Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Bombardment Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Bombardment Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BombardmentTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Bombardment Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.33 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.90 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.18 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.59 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 160.31 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 58.72 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.15 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
r 2.90 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.90 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkrstomonnnnonnnnonnnnlonnnnqomonnnnonnnnonnnnonnnnomonnnnonnnnonjlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnkronnnnomonnnnoqnnnnonnnnojlomonnnnonnnpnonnnnomonnnnonnnnonnjlomonnnnonnnnonnnnomonnnnonnnnonnnnojkrtomonnnnonnnqnlonnnnomonnnnonnnnonnnpnomonnnnonnjlo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat N am_spam Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Q flask Bombardment 65394.3/65394: 100% mana
Pre precombat R food Bombardment 65394.3/65394: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 65394.3/65394: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 64394.3/65394: 98% mana
0:01.261 aoe k arcane_power Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.261 shared_cds r use_items Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
0:01.261 shared_cds s potion Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
0:01.261 shared_cds t berserking Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.261 aoe o arcane_barrage Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.145 aoe m arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.028 aoe o arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.910 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.792 aoe n arcane_explosion Fluffy_Pillow 64047.8/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.675 aoe n arcane_explosion Fluffy_Pillow 62702.7/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.560 aoe n arcane_explosion Fluffy_Pillow 61360.2/65394: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.444 aoe o arcane_barrage Fluffy_Pillow 62516.4/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.330 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.212 aoe n arcane_explosion Fluffy_Pillow 64047.8/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.097 aoe n arcane_explosion Fluffy_Pillow 62705.3/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.981 aoe n arcane_explosion Fluffy_Pillow 61361.5/65394: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.865 aoe o arcane_barrage Fluffy_Pillow 60017.7/65394: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.748 aoe n arcane_explosion Fluffy_Pillow 63788.3/65394: 98% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.631 aoe n arcane_explosion Fluffy_Pillow 62443.2/65394: 95% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.601 aoe n arcane_explosion Fluffy_Pillow 61211.8/65394: 94% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.573 aoe n arcane_explosion Fluffy_Pillow 59983.1/65394: 92% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.544 aoe l rune_of_power Fluffy_Pillow 58753.0/65394: 90% mana bloodlust, arcane_charge(4), clearcasting, crimson_chorus(2), potion_of_deathly_fixation
0:17.515 aoe o arcane_barrage Fluffy_Pillow 60023.0/65394: 92% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.485 aoe n arcane_explosion Fluffy_Pillow 63907.4/65394: 98% mana bloodlust, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.456 aoe n arcane_explosion Fluffy_Pillow 65177.4/65394: 100% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.428 aoe n arcane_explosion Fluffy_Pillow 61448.6/65394: 94% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.398 aoe n arcane_explosion Fluffy_Pillow 57717.3/65394: 88% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.369 shared_cds q use_mana_gem Bombardment 53987.2/65394: 83% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.369 aoe o arcane_barrage Fluffy_Pillow 60526.7/65394: 93% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.341 aoe m arcane_orb Fluffy_Pillow 64413.7/65394: 99% mana bloodlust, clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.314 aoe o arcane_barrage Fluffy_Pillow 65186.3/65394: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.285 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.257 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.229 aoe n arcane_explosion Fluffy_Pillow 61665.6/65394: 94% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:28.201 aoe n arcane_explosion Fluffy_Pillow 57936.8/65394: 89% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:29.172 aoe o arcane_barrage Fluffy_Pillow 54206.8/65394: 83% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:30.143 aoe n arcane_explosion Fluffy_Pillow 58092.5/65394: 89% mana bloodlust, crimson_chorus(3)
0:31.115 aoe n arcane_explosion Fluffy_Pillow 54363.8/65394: 83% mana bloodlust, arcane_charge, clearcasting
0:32.086 aoe n arcane_explosion Fluffy_Pillow 55633.7/65394: 85% mana bloodlust, arcane_charge(2)
0:33.056 aoe n arcane_explosion Fluffy_Pillow 51902.4/65394: 79% mana bloodlust, arcane_charge(3)
0:34.028 aoe o arcane_barrage Fluffy_Pillow 48173.6/65394: 74% mana bloodlust, arcane_charge(4)
0:34.998 aoe n arcane_explosion Fluffy_Pillow 52058.1/65394: 80% mana bloodlust
0:35.970 aoe n arcane_explosion Fluffy_Pillow 48329.3/65394: 74% mana bloodlust, arcane_charge
0:36.942 aoe n arcane_explosion Fluffy_Pillow 44600.6/65394: 68% mana bloodlust, arcane_charge(2)
0:37.912 aoe n arcane_explosion Fluffy_Pillow 40869.2/65394: 62% mana bloodlust, arcane_charge(3)
0:38.885 aoe o arcane_barrage Fluffy_Pillow 37141.8/65394: 57% mana bloodlust, arcane_charge(4), clearcasting
0:39.859 aoe n arcane_explosion Fluffy_Pillow 41031.5/65394: 63% mana bloodlust, clearcasting
0:40.830 aoe n arcane_explosion Fluffy_Pillow 42301.4/65394: 65% mana bloodlust, arcane_charge
0:41.800 aoe n arcane_explosion Fluffy_Pillow 38570.1/65394: 59% mana arcane_charge(2)
0:43.064 aoe n arcane_explosion Fluffy_Pillow 35223.2/65394: 54% mana arcane_charge(3)
0:44.325 aoe o arcane_barrage Fluffy_Pillow 31872.5/65394: 49% mana arcane_charge(4)
0:45.587 aoe m arcane_orb Fluffy_Pillow 36138.8/65394: 55% mana
0:46.850 aoe o arcane_barrage Fluffy_Pillow 37290.7/65394: 57% mana arcane_charge(4), clearcasting
0:48.113 aoe n arcane_explosion Fluffy_Pillow 41558.3/65394: 64% mana clearcasting
0:49.373 aoe n arcane_explosion Fluffy_Pillow 43206.2/65394: 66% mana arcane_charge
0:50.635 aoe n arcane_explosion Fluffy_Pillow 39856.8/65394: 61% mana arcane_charge(2)
0:51.894 aoe n arcane_explosion Fluffy_Pillow 36503.4/65394: 56% mana arcane_charge(3)
0:53.157 aoe o arcane_barrage Fluffy_Pillow 33155.3/65394: 51% mana arcane_charge(4), clearcasting
0:54.417 aoe n arcane_explosion Fluffy_Pillow 37419.0/65394: 57% mana clearcasting
0:55.678 aoe n arcane_explosion Fluffy_Pillow 39068.2/65394: 60% mana arcane_charge
0:56.939 aoe n arcane_explosion Fluffy_Pillow 35717.5/65394: 55% mana arcane_charge(2), clearcasting
0:58.201 aoe n arcane_explosion Fluffy_Pillow 37368.0/65394: 57% mana arcane_charge(3)
0:59.463 aoe o arcane_barrage Fluffy_Pillow 34018.6/65394: 52% mana arcane_charge(4)
1:00.727 aoe n arcane_explosion Fluffy_Pillow 38287.5/65394: 59% mana
1:01.988 aoe j touch_of_the_magi Fluffy_Pillow 34936.8/65394: 53% mana arcane_charge, clearcasting, crimson_chorus
1:03.249 aoe l rune_of_power Fluffy_Pillow 34086.0/65394: 52% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.509 aoe o arcane_barrage Fluffy_Pillow 35733.9/65394: 55% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:05.770 aoe m arcane_orb Fluffy_Pillow 39998.9/65394: 61% mana clearcasting, rune_of_power, crimson_chorus
1:07.031 aoe o arcane_barrage Fluffy_Pillow 41148.2/65394: 63% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:08.293 aoe n arcane_explosion Fluffy_Pillow 45414.5/65394: 69% mana clearcasting, rune_of_power, crimson_chorus
1:09.555 aoe n arcane_explosion Fluffy_Pillow 47065.1/65394: 72% mana arcane_charge, rune_of_power, crimson_chorus
1:10.818 aoe n arcane_explosion Fluffy_Pillow 43716.9/65394: 67% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
1:12.080 aoe n arcane_explosion Fluffy_Pillow 40367.5/65394: 62% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:13.342 aoe o arcane_barrage Fluffy_Pillow 37018.0/65394: 57% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.604 aoe n arcane_explosion Fluffy_Pillow 41284.4/65394: 63% mana rune_of_power, crimson_chorus(2)
1:15.864 aoe n arcane_explosion Fluffy_Pillow 37932.3/65394: 58% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.127 aoe n arcane_explosion Fluffy_Pillow 34584.1/65394: 53% mana arcane_charge(2), crimson_chorus(2)
1:18.388 aoe n arcane_explosion Fluffy_Pillow 31233.4/65394: 48% mana arcane_charge(3), crimson_chorus(2)
1:19.649 aoe o arcane_barrage Fluffy_Pillow 27882.6/65394: 43% mana arcane_charge(4), crimson_chorus(2)
1:20.910 aoe n arcane_explosion Fluffy_Pillow 32147.6/65394: 49% mana crimson_chorus(3)
1:22.173 aoe n arcane_explosion Fluffy_Pillow 28799.5/65394: 44% mana arcane_charge, crimson_chorus(3)
1:23.434 aoe n arcane_explosion Fluffy_Pillow 25448.8/65394: 39% mana arcane_charge(2), crimson_chorus(3)
1:24.699 aoe n arcane_explosion Fluffy_Pillow 22103.2/65394: 34% mana arcane_charge(3), clearcasting, crimson_chorus(3)
1:25.959 aoe o arcane_barrage Fluffy_Pillow 23751.2/65394: 36% mana arcane_charge(4), crimson_chorus(3)
1:27.220 aoe m arcane_orb Fluffy_Pillow 28016.2/65394: 43% mana crimson_chorus(3)
1:28.482 aoe o arcane_barrage Fluffy_Pillow 29166.7/65394: 45% mana arcane_charge(4), crimson_chorus(3)
1:29.743 aoe n arcane_explosion Fluffy_Pillow 33431.7/65394: 51% mana crimson_chorus(3)
1:31.003 aoe n arcane_explosion Fluffy_Pillow 30079.7/65394: 46% mana arcane_charge
1:32.265 aoe n arcane_explosion Fluffy_Pillow 26730.2/65394: 41% mana arcane_charge(2)
1:33.529 aoe n arcane_explosion Fluffy_Pillow 23383.4/65394: 36% mana arcane_charge(3)
1:34.792 aoe o arcane_barrage Fluffy_Pillow 20035.3/65394: 31% mana arcane_charge(4)
1:36.052 aoe n arcane_explosion Fluffy_Pillow 24299.0/65394: 37% mana
1:37.314 aoe n arcane_explosion Fluffy_Pillow 20949.5/65394: 32% mana arcane_charge
1:38.575 aoe n arcane_explosion Fluffy_Pillow 17598.8/65394: 27% mana arcane_charge(2)
1:39.836 aoe n arcane_explosion Fluffy_Pillow 14248.0/65394: 22% mana arcane_charge(3)
1:41.097 aoe o arcane_barrage Fluffy_Pillow 10897.3/65394: 17% mana arcane_charge(4), clearcasting
1:42.358 aoe n arcane_explosion Fluffy_Pillow 15162.3/65394: 23% mana clearcasting
1:43.620 aoe n arcane_explosion Fluffy_Pillow 16812.8/65394: 26% mana arcane_charge
1:44.880 aoe n arcane_explosion Fluffy_Pillow 13460.8/65394: 21% mana arcane_charge(2)
1:46.141 aoe n arcane_explosion Fluffy_Pillow 10110.0/65394: 15% mana arcane_charge(3)
1:47.402 aoe o arcane_barrage Fluffy_Pillow 6759.2/65394: 10% mana arcane_charge(4)
1:48.665 aoe j touch_of_the_magi Fluffy_Pillow 11026.9/65394: 17% mana
1:49.926 aoe l rune_of_power Fluffy_Pillow 10176.1/65394: 16% mana arcane_charge(4)
1:51.188 aoe o arcane_barrage Fluffy_Pillow 11826.7/65394: 18% mana arcane_charge(4), rune_of_power
1:52.449 aoe m arcane_orb Fluffy_Pillow 16091.7/65394: 25% mana rune_of_power
1:53.712 aoe o arcane_barrage Fluffy_Pillow 17243.5/65394: 26% mana arcane_charge(4), rune_of_power
1:54.974 aoe n arcane_explosion Fluffy_Pillow 21509.9/65394: 33% mana rune_of_power
1:56.237 aoe n arcane_explosion Fluffy_Pillow 18161.7/65394: 28% mana arcane_charge, rune_of_power
1:57.499 aoe n arcane_explosion Fluffy_Pillow 14812.3/65394: 23% mana arcane_charge(2), rune_of_power
1:58.760 aoe n arcane_explosion Fluffy_Pillow 11461.5/65394: 18% mana arcane_charge(3), clearcasting, rune_of_power
2:00.022 aoe o arcane_barrage Fluffy_Pillow 13112.1/65394: 20% mana arcane_charge(4), rune_of_power
2:01.284 aoe n arcane_explosion Fluffy_Pillow 17378.4/65394: 27% mana rune_of_power
2:02.545 aoe n arcane_explosion Fluffy_Pillow 14027.6/65394: 21% mana arcane_charge, rune_of_power, crimson_chorus
2:03.805 aoe n arcane_explosion Fluffy_Pillow 10675.6/65394: 16% mana arcane_charge(2), crimson_chorus
2:05.068 aoe n arcane_explosion Fluffy_Pillow 7327.4/65394: 11% mana arcane_charge(3), crimson_chorus
2:06.331 aoe k arcane_power Fluffy_Pillow 3979.3/65394: 6% mana arcane_charge(4), crimson_chorus
2:06.331 shared_cds r use_items Fluffy_Pillow 3979.3/65394: 6% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:06.331 aoe o arcane_barrage Fluffy_Pillow 3979.3/65394: 6% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:07.592 aoe n arcane_explosion Fluffy_Pillow 8244.3/65394: 13% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.853 aoe n arcane_explosion Fluffy_Pillow 7393.6/65394: 11% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.114 aoe n arcane_explosion Fluffy_Pillow 6542.8/65394: 10% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.376 aoe n arcane_explosion Fluffy_Pillow 5693.4/65394: 9% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:12.636 aoe o arcane_barrage Fluffy_Pillow 7341.3/65394: 11% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.898 aoe m arcane_orb Fluffy_Pillow 11607.6/65394: 18% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.158 aoe o arcane_barrage Fluffy_Pillow 13005.5/65394: 20% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.420 aoe n arcane_explosion Fluffy_Pillow 17271.9/65394: 26% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.681 aoe n arcane_explosion Fluffy_Pillow 16421.1/65394: 25% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.943 aoe n arcane_explosion Fluffy_Pillow 15571.7/65394: 24% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
2:20.205 aoe n arcane_explosion Fluffy_Pillow 14722.2/65394: 23% mana arcane_charge(3), arcane_power, crimson_chorus(2), gladiators_badge
2:21.467 aoe o arcane_barrage Fluffy_Pillow 13872.8/65394: 21% mana arcane_charge(4), crimson_chorus(3)
2:22.728 shared_cds q use_mana_gem Bombardment 18137.8/65394: 28% mana crimson_chorus(3)
2:22.728 aoe n arcane_explosion Fluffy_Pillow 24677.2/65394: 38% mana crimson_chorus(3)
2:23.988 aoe n arcane_explosion Fluffy_Pillow 21325.2/65394: 33% mana arcane_charge, crimson_chorus(3)
2:25.249 aoe n arcane_explosion Fluffy_Pillow 17974.4/65394: 27% mana arcane_charge(2), crimson_chorus(3)
2:26.511 aoe n arcane_explosion Fluffy_Pillow 14624.9/65394: 22% mana arcane_charge(3), crimson_chorus(3)
2:27.772 aoe o arcane_barrage Fluffy_Pillow 11274.2/65394: 17% mana arcane_charge(4), crimson_chorus(3)
2:29.032 aoe n arcane_explosion Fluffy_Pillow 15537.9/65394: 24% mana crimson_chorus(3)
2:30.294 aoe n arcane_explosion Fluffy_Pillow 12188.4/65394: 19% mana arcane_charge, crimson_chorus(3)
2:31.557 aoe n arcane_explosion Fluffy_Pillow 8840.3/65394: 14% mana arcane_charge(2)
2:32.819 aoe n arcane_explosion Fluffy_Pillow 5490.9/65394: 8% mana arcane_charge(3), clearcasting
2:34.079 aoe o arcane_barrage Fluffy_Pillow 7138.8/65394: 11% mana arcane_charge(4)
2:35.340 aoe j touch_of_the_magi Fluffy_Pillow 11403.8/65394: 17% mana
2:36.602 aoe l rune_of_power Fluffy_Pillow 10554.4/65394: 16% mana arcane_charge(4)
2:37.864 aoe o arcane_barrage Fluffy_Pillow 12204.9/65394: 19% mana arcane_charge(4), rune_of_power
2:39.128 aoe m arcane_orb Fluffy_Pillow 16473.9/65394: 25% mana rune_of_power
2:40.390 aoe o arcane_barrage Fluffy_Pillow 17624.4/65394: 27% mana arcane_charge(4), rune_of_power
2:41.652 aoe n arcane_explosion Fluffy_Pillow 21890.7/65394: 33% mana rune_of_power
2:42.912 aoe n arcane_explosion Fluffy_Pillow 18538.7/65394: 28% mana arcane_charge, rune_of_power
2:44.175 aoe n arcane_explosion Fluffy_Pillow 15190.5/65394: 23% mana arcane_charge(2), rune_of_power
2:45.437 aoe n arcane_explosion Fluffy_Pillow 11841.1/65394: 18% mana arcane_charge(3), rune_of_power
2:46.700 aoe o arcane_barrage Fluffy_Pillow 8492.9/65394: 13% mana arcane_charge(4), rune_of_power
2:47.960 aoe n arcane_explosion Fluffy_Pillow 12756.6/65394: 20% mana rune_of_power
2:49.222 aoe n arcane_explosion Fluffy_Pillow 9407.2/65394: 14% mana arcane_charge, rune_of_power
2:50.482 aoe n arcane_explosion Fluffy_Pillow 6055.1/65394: 9% mana arcane_charge(2)
2:51.743 aoe p evocation Bombardment 2704.4/65394: 4% mana arcane_charge(3)
2:55.938 aoe n arcane_explosion Fluffy_Pillow 58254.5/65394: 89% mana arcane_charge(3)
2:57.200 aoe o arcane_barrage Fluffy_Pillow 54905.0/65394: 84% mana arcane_charge(4)
2:58.462 aoe n arcane_explosion Fluffy_Pillow 59171.3/65394: 90% mana
2:59.722 aoe n arcane_explosion Fluffy_Pillow 55819.3/65394: 85% mana arcane_charge
3:00.985 aoe n arcane_explosion Fluffy_Pillow 52471.1/65394: 80% mana arcane_charge(2)
3:02.246 aoe n arcane_explosion Fluffy_Pillow 49120.4/65394: 75% mana arcane_charge(3), clearcasting
3:03.506 aoe o arcane_barrage Fluffy_Pillow 50768.3/65394: 78% mana arcane_charge(4), crimson_chorus
3:04.767 aoe m arcane_orb Fluffy_Pillow 55033.3/65394: 84% mana crimson_chorus
3:06.029 aoe o arcane_barrage Fluffy_Pillow 56183.9/65394: 86% mana arcane_charge(4), crimson_chorus
3:07.290 aoe n arcane_explosion Fluffy_Pillow 60448.9/65394: 92% mana crimson_chorus
3:08.551 aoe n arcane_explosion Fluffy_Pillow 57098.1/65394: 87% mana arcane_charge, crimson_chorus
3:09.813 aoe n arcane_explosion Fluffy_Pillow 53748.7/65394: 82% mana arcane_charge(2), crimson_chorus
3:11.073 aoe n arcane_explosion Fluffy_Pillow 50396.6/65394: 77% mana arcane_charge(3), crimson_chorus
3:12.335 aoe o arcane_barrage Fluffy_Pillow 47047.2/65394: 72% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:13.595 aoe n arcane_explosion Fluffy_Pillow 51310.9/65394: 78% mana clearcasting, crimson_chorus(2)
3:14.856 aoe n arcane_explosion Fluffy_Pillow 52960.1/65394: 81% mana arcane_charge, crimson_chorus(2)
3:16.119 aoe n arcane_explosion Fluffy_Pillow 49612.0/65394: 76% mana arcane_charge(2), crimson_chorus(2)
3:17.380 aoe n arcane_explosion Fluffy_Pillow 46261.2/65394: 71% mana arcane_charge(3), crimson_chorus(2)
3:18.641 aoe o arcane_barrage Fluffy_Pillow 42910.5/65394: 66% mana arcane_charge(4), crimson_chorus(2)
3:19.902 aoe n arcane_explosion Fluffy_Pillow 47175.5/65394: 72% mana crimson_chorus(2)
3:21.163 aoe n arcane_explosion Fluffy_Pillow 43824.7/65394: 67% mana arcane_charge, crimson_chorus(2)
3:22.424 aoe j touch_of_the_magi Fluffy_Pillow 40474.0/65394: 62% mana arcane_charge(2), crimson_chorus(3)
3:23.685 aoe l rune_of_power Fluffy_Pillow 39623.2/65394: 61% mana arcane_charge(4), crimson_chorus(3)
3:24.948 aoe o arcane_barrage Fluffy_Pillow 41275.1/65394: 63% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:26.208 aoe m arcane_orb Fluffy_Pillow 45538.8/65394: 70% mana rune_of_power, crimson_chorus(3)
3:27.469 aoe o arcane_barrage Fluffy_Pillow 46688.0/65394: 71% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:28.730 aoe n arcane_explosion Fluffy_Pillow 50953.0/65394: 78% mana rune_of_power, crimson_chorus(3)
3:29.990 aoe n arcane_explosion Fluffy_Pillow 47601.0/65394: 73% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:31.251 aoe n arcane_explosion Fluffy_Pillow 44250.2/65394: 68% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
3:32.513 aoe n arcane_explosion Fluffy_Pillow 40900.8/65394: 63% mana arcane_charge(3), rune_of_power
3:33.774 aoe o arcane_barrage Fluffy_Pillow 37550.0/65394: 57% mana arcane_charge(4), rune_of_power
3:35.035 aoe n arcane_explosion Fluffy_Pillow 41815.0/65394: 64% mana rune_of_power
3:36.296 aoe n arcane_explosion Fluffy_Pillow 38464.3/65394: 59% mana arcane_charge, rune_of_power
3:37.556 aoe n arcane_explosion Fluffy_Pillow 35112.2/65394: 54% mana arcane_charge(2)
3:38.816 aoe n arcane_explosion Fluffy_Pillow 31760.1/65394: 49% mana arcane_charge(3)
3:40.079 aoe o arcane_barrage Fluffy_Pillow 28412.0/65394: 43% mana arcane_charge(4)
3:41.341 aoe n arcane_explosion Fluffy_Pillow 32678.3/65394: 50% mana
3:42.604 aoe n arcane_explosion Fluffy_Pillow 29330.2/65394: 45% mana arcane_charge
3:43.865 aoe n arcane_explosion Fluffy_Pillow 25979.4/65394: 40% mana arcane_charge(2)
3:45.127 aoe n arcane_explosion Fluffy_Pillow 22630.0/65394: 35% mana arcane_charge(3)
3:46.387 aoe o arcane_barrage Fluffy_Pillow 19277.9/65394: 29% mana arcane_charge(4)
3:47.649 aoe m arcane_orb Fluffy_Pillow 23544.2/65394: 36% mana
3:48.910 aoe o arcane_barrage Fluffy_Pillow 24693.5/65394: 38% mana arcane_charge(4)
3:50.173 aoe n arcane_explosion Fluffy_Pillow 28961.1/65394: 44% mana
3:51.434 aoe n arcane_explosion Fluffy_Pillow 25610.4/65394: 39% mana arcane_charge
3:52.696 aoe n arcane_explosion Fluffy_Pillow 22260.9/65394: 34% mana arcane_charge(2)
3:53.960 aoe n arcane_explosion Fluffy_Pillow 18914.1/65394: 29% mana arcane_charge(3)
3:55.220 aoe o arcane_barrage Fluffy_Pillow 15562.0/65394: 24% mana arcane_charge(4)
3:56.482 aoe n arcane_explosion Fluffy_Pillow 19828.3/65394: 30% mana
3:57.746 aoe n arcane_explosion Fluffy_Pillow 16481.5/65394: 25% mana arcane_charge
3:59.006 aoe n arcane_explosion Fluffy_Pillow 13129.4/65394: 20% mana arcane_charge(2), clearcasting
4:00.268 aoe n arcane_explosion Fluffy_Pillow 14780.0/65394: 23% mana arcane_charge(3)
4:01.530 aoe o arcane_barrage Fluffy_Pillow 11430.5/65394: 17% mana arcane_charge(4)
4:02.789 aoe n arcane_explosion Fluffy_Pillow 15692.9/65394: 24% mana
4:04.049 aoe n arcane_explosion Fluffy_Pillow 12340.9/65394: 19% mana arcane_charge, crimson_chorus
4:05.311 aoe n arcane_explosion Fluffy_Pillow 8991.4/65394: 14% mana arcane_charge(2), crimson_chorus
4:06.572 aoe n arcane_explosion Fluffy_Pillow 5640.7/65394: 9% mana arcane_charge(3), crimson_chorus
4:07.833 aoe o arcane_barrage Fluffy_Pillow 2289.9/65394: 4% mana arcane_charge(4), clearcasting, crimson_chorus
4:09.095 aoe j touch_of_the_magi Fluffy_Pillow 6556.2/65394: 10% mana clearcasting, crimson_chorus
4:10.356 aoe k arcane_power Fluffy_Pillow 5705.5/65394: 9% mana arcane_charge(4), clearcasting, crimson_chorus
4:10.356 shared_cds r use_items Fluffy_Pillow 5705.5/65394: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus
4:10.356 shared_cds t berserking Fluffy_Pillow 5705.5/65394: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:10.356 aoe o arcane_barrage Fluffy_Pillow 5705.5/65394: 9% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:11.502 aoe m arcane_orb Fluffy_Pillow 9820.1/65394: 15% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:12.651 aoe o arcane_barrage Fluffy_Pillow 11072.9/65394: 17% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:13.798 aoe n arcane_explosion Fluffy_Pillow 15188.8/65394: 23% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.944 aoe n arcane_explosion Fluffy_Pillow 16687.6/65394: 26% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.092 aoe n arcane_explosion Fluffy_Pillow 15689.1/65394: 24% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.239 aoe n arcane_explosion Fluffy_Pillow 14689.2/65394: 22% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.387 aoe o arcane_barrage Fluffy_Pillow 13690.7/65394: 21% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.534 aoe n arcane_explosion Fluffy_Pillow 17806.6/65394: 27% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.683 aoe n arcane_explosion Fluffy_Pillow 16809.3/65394: 26% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.829 aoe n arcane_explosion Fluffy_Pillow 15808.2/65394: 24% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.977 shared_cds q use_mana_gem Bombardment 14809.6/65394: 23% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:22.977 aoe n arcane_explosion Fluffy_Pillow 21349.1/65394: 33% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:24.240 aoe l rune_of_power Fluffy_Pillow 20500.9/65394: 31% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:25.502 aoe o arcane_barrage Fluffy_Pillow 22151.5/65394: 34% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:26.764 aoe n arcane_explosion Fluffy_Pillow 26417.8/65394: 40% mana rune_of_power, crimson_chorus(3)
4:28.026 aoe n arcane_explosion Fluffy_Pillow 23068.3/65394: 35% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:29.287 aoe n arcane_explosion Fluffy_Pillow 19717.6/65394: 30% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
4:30.547 aoe n arcane_explosion Fluffy_Pillow 16365.5/65394: 25% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
4:31.809 aoe o arcane_barrage Fluffy_Pillow 13016.1/65394: 20% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:33.071 aoe m arcane_orb Fluffy_Pillow 17282.4/65394: 26% mana rune_of_power
4:34.331 aoe o arcane_barrage Fluffy_Pillow 18430.3/65394: 28% mana arcane_charge(4), rune_of_power
4:35.592 aoe n arcane_explosion Fluffy_Pillow 22695.4/65394: 35% mana rune_of_power
4:36.852 aoe n arcane_explosion Fluffy_Pillow 19343.3/65394: 30% mana arcane_charge, rune_of_power
4:38.115 aoe n arcane_explosion Fluffy_Pillow 15995.1/65394: 24% mana arcane_charge(2)
4:39.375 aoe n arcane_explosion Fluffy_Pillow 12643.1/65394: 19% mana arcane_charge(3)
4:40.636 aoe o arcane_barrage Fluffy_Pillow 9292.3/65394: 14% mana arcane_charge(4)
4:41.898 aoe n arcane_explosion Fluffy_Pillow 13558.7/65394: 21% mana
4:43.160 aoe n arcane_explosion Fluffy_Pillow 10209.2/65394: 16% mana arcane_charge
4:44.422 aoe n arcane_explosion Fluffy_Pillow 6859.8/65394: 10% mana arcane_charge(2)
4:45.684 aoe n arcane_explosion Fluffy_Pillow 3510.3/65394: 5% mana arcane_charge(3), clearcasting
4:46.943 aoe o arcane_barrage Fluffy_Pillow 5156.9/65394: 8% mana arcane_charge(4)
4:48.207 aoe n arcane_explosion Fluffy_Pillow 9425.9/65394: 14% mana
4:49.470 aoe n arcane_explosion Fluffy_Pillow 6077.7/65394: 9% mana arcane_charge, clearcasting
4:50.731 aoe n arcane_explosion Fluffy_Pillow 7727.0/65394: 12% mana arcane_charge(2)
4:51.993 aoe p evocation Fluffy_Pillow 4377.5/65394: 7% mana arcane_charge(3)
4:56.187 aoe n arcane_explosion Fluffy_Pillow 59926.3/65394: 92% mana arcane_charge(3)
4:57.448 aoe o arcane_barrage Fluffy_Pillow 56575.5/65394: 87% mana arcane_charge(4)
4:58.710 aoe m arcane_orb Fluffy_Pillow 60841.9/65394: 93% mana
4:59.972 aoe o arcane_barrage Fluffy_Pillow 61992.4/65394: 95% mana arcane_charge(4)
5:01.233 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana
5:02.493 aoe n arcane_explosion Fluffy_Pillow 62042.2/65394: 95% mana arcane_charge
5:03.753 aoe n arcane_explosion Fluffy_Pillow 58690.2/65394: 90% mana arcane_charge(2)
5:05.015 aoe n arcane_explosion Fluffy_Pillow 55340.7/65394: 85% mana arcane_charge(3), crimson_chorus
5:06.276 aoe o arcane_barrage Fluffy_Pillow 51990.0/65394: 80% mana arcane_charge(4), clearcasting, crimson_chorus
5:07.538 aoe n arcane_explosion Fluffy_Pillow 56256.3/65394: 86% mana clearcasting, crimson_chorus
5:08.798 aoe n arcane_explosion Fluffy_Pillow 57904.2/65394: 89% mana arcane_charge, crimson_chorus
5:10.060 aoe j touch_of_the_magi Fluffy_Pillow 54554.8/65394: 83% mana arcane_charge(2), crimson_chorus
5:11.323 aoe l rune_of_power Fluffy_Pillow 53706.6/65394: 82% mana arcane_charge(4), crimson_chorus
5:12.584 aoe o arcane_barrage Fluffy_Pillow 55355.9/65394: 85% mana arcane_charge(4), rune_of_power, crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 65394 65394 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 19.24% 19.24% 635
Versatility 7.97% 7.97% 319
Mana Regen 1308 1308 0
Mastery 30.79% 30.79% 618
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Bombardment"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6649/6650/6758/6927/1532,ilevel=235,enchant_id=6168
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=635
# gear_mastery_rating=618
# gear_versatility_rating=319
# gear_armor=369

Harmony : 13576 dps, 4741 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13576.1 13576.1 24.6 / 0.181% 1535.7 / 11.3% 6.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
2071.0 1960.4 Mana 0.00% 49.0 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Harmony 13576
Arcane Barrage 5789 42.6% 50.4 5.96sec 34300 28577 Direct 251.4 5753 11746 6870 18.6%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.35 251.40 0.00 0.00 1.2003 0.0000 1727060.75 1727060.75 0.00% 28576.69 28576.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 204.53 146 259 5753.31 1484 35440 5757.90 5045 6603 1176483 1176483 0.00%
crit 18.64% 46.87 21 74 11746.36 2967 70880 11765.81 8777 17354 550578 550578 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:50.35
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [t]:0.00
Arcane Blast 0 0.0% 0.0 0.00sec 1951 1279 Direct 0.0 1951 0 1951 0.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.6635 0.0000 3.84 3.84 0.00% 1278.85 1278.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 0.00 0 1 1950.88 1606 2296 3.84 0 2296 4 4 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [s]:0.00
Arcane Explosion 4948 36.5% 131.2 2.25sec 11252 9400 Direct 656.1 1882 3859 2251 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.22 656.11 0.00 0.00 1.1970 0.0000 1476496.15 1476496.15 0.00% 9400.36 9400.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.33% 533.62 398 680 1881.53 1391 3757 1882.04 1756 2024 1003937 1003937 0.00%
crit 18.67% 122.50 74 178 3859.05 2782 7514 3857.79 3352 4371 472559 472559 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:131.25
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1011 7.5% 24.8 11.63sec 12182 6538 Periodic 197.8 1282 2606 1527 18.5% 2.7%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.80 0.00 197.93 197.82 1.8633 0.2019 302142.21 302142.21 0.00% 6538.03 6538.03
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 81.48% 161.18 71 261 1281.91 1020 2754 1281.39 1048 1551 206645 206645 0.00%
crit 18.52% 36.64 16 70 2605.58 2039 5507 2604.86 2118 3563 95497 95497 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [n]:24.79
  • if_expr:buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
Arcane Orb 0 (981) 0.0% (7.2%) 12.7 24.26sec 22983 19086

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2042 0.0000 0.00 0.00 0.00% 19085.91 19085.91

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:12.73
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [r]:0.00
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 981 7.2% 63.5 24.26sec 4606 0 Direct 63.5 3861 7873 4609 18.7%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.53 63.53 0.00 0.00 0.0000 0.0000 292606.05 292606.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.34% 51.67 31 71 3860.83 2749 7425 3859.24 3097 4454 199366 199366 0.00%
crit 18.66% 11.85 3 25 7873.25 5498 14849 7870.54 5498 11212 93240 93240 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.5%) 14.8 1.68sec 1364 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.5% 14.8 1.68sec 1364 0 Direct 14.8 1133 2269 1363 20.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.78 14.78 0.00 0.00 0.0000 0.0000 20155.96 20155.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 11.78 5 20 1133.18 1117 1184 1133.35 1117 1184 13349 13349 0.00%
crit 20.30% 3.00 0 10 2268.67 2233 2367 2160.97 0 2367 6807 6807 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 38 0.3% 20.6 14.02sec 548 0 Direct 20.6 462 924 548 18.5%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.59 20.59 0.00 0.00 0.0000 0.0000 11276.31 11276.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.45% 16.77 7 33 461.96 453 481 461.99 453 474 7749 7749 0.00%
crit 18.55% 3.82 0 11 923.65 907 961 915.87 0 961 3528 3528 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1193 16.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1193.81 1193.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.38% 0.83 0 1 1023.69 1024 1024 853.58 0 1024 854 854 0.00%
crit 16.62% 0.17 0 1 2047.39 2047 2047 340.22 0 2047 340 340 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (15) 0.0% (0.1%) 1.0 0.00sec 4551 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 114  / 15 0.1% 93.0 1.25sec 49 39 Direct 93.0 41 82 49 20.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2644 0.0000 4550.82 4550.82 0.00% 38.70 38.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.91% 74.32 59 87 40.62 30 51 40.62 39 43 3019 3019 0.00%
crit 20.09% 18.68 6 34 82.00 59 101 81.95 72 92 1532 1532 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (721) 0.0% (5.3%) 6.2 51.70sec 34596 27427

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2614 0.0000 0.00 0.00 0.00% 27427.22 27427.22

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.22
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 721 5.3% 6.2 51.55sec 34596 0 Direct 30.9 6942 0 6942 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 30.95 0.00 0.00 0.0000 0.0000 214755.12 214755.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.95 20 40 6941.70 479 41922 6939.65 4898 10754 214755 214755 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22486.11
  • base_dd_max:22486.11
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Harmony
Arcane Power 2.9 126.55sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 252.91sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [x]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 170.08sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 7.08 0.00 4.1536 0.6970 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Harmony
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.19
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Harmony
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Harmony
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.13sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2136 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.41sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Harmony
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [u]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 51.1 162.5 5.9sec 1.4sec 4.6sec 78.10% 0.00% 27.7 (28.9) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.8s
  • trigger_min/max:0.0s / 7.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s

Stack Uptimes

  • arcane_charge_1:20.47%
  • arcane_charge_2:17.97%
  • arcane_charge_3:17.18%
  • arcane_charge_4:22.48%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Harmony 20.0 177.9 14.5sec 1.4sec 4.4sec 29.28% 0.00% 10.7 (10.7) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_arcane_harmony
  • max_stacks:15
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 102.1s
  • trigger_min/max:0.1s / 100.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.1s

Stack Uptimes

  • arcane_harmony_1:3.25%
  • arcane_harmony_2:1.46%
  • arcane_harmony_3:1.46%
  • arcane_harmony_4:1.46%
  • arcane_harmony_5:1.46%
  • arcane_harmony_6:1.46%
  • arcane_harmony_7:1.45%
  • arcane_harmony_8:12.10%
  • arcane_harmony_9:0.65%
  • arcane_harmony_10:0.39%
  • arcane_harmony_11:0.39%
  • arcane_harmony_12:0.39%
  • arcane_harmony_13:0.39%
  • arcane_harmony_14:0.39%
  • arcane_harmony_15:2.59%

Spelldata

  • id:332777
  • name:Arcane Harmony
  • tooltip:Increases the damage of your next Arcane Barrage by {$s1=7}%.
  • description:{$@spelldesc332769=Each time Arcane Missiles hits an enemy, the damage of your next Arcane Barrage is increased by {$332777s1=7}%. This effect stacks up to {$332777u=15} times.}
  • max_stacks:15
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Arcane Power 2.9 0.0 126.6sec 126.6sec 14.7sec 14.09% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.5s
  • trigger_min/max:120.0s / 138.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.09%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.1sec 253.1sec 11.7sec 7.26% 17.63% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.4s / 270.8s
  • trigger_min/max:240.4s / 270.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.26%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.0 0.0 11.6sec 11.6sec 1.3sec 10.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.46%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.7sec 51.92% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.7s
  • trigger_min/max:60.0s / 66.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.90%
  • crimson_chorus_2:17.31%
  • crimson_chorus_3:16.71%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 174.9sec 174.9sec 4.2sec 1.66% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:100.3s / 249.2s
  • trigger_min/max:100.3s / 249.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.2s

Stack Uptimes

  • evocation_1:1.66%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 126.6sec 126.6sec 14.7sec 14.09% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:120.0s / 138.5s
  • trigger_min/max:120.0s / 138.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.09%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.8sec 34.8sec 11.8sec 35.21% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 63.0s
  • trigger_min/max:12.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.21%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 2 0.00% 0.00% 1.89%
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.96%
Arcane Barrage Arcane Charge 4 100.00% 98.04% 100.00%
Arcane Blast Arcane Charge 1 0.10% 0.00% 100.00%
Arcane Blast Arcane Charge 2 0.10% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.71% 0.73% 5.87% 0.8s 0.0s 4.0s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation141.03510.262343.575209.247134.023349.744
Rune of Power5.8470.00233.18336.75216.29679.352
Touch of the Magi4.5740.00025.22429.71814.07277.800
Arcane Power4.7690.00018.52113.8641.69032.106
Arcane Barrage3.5140.00014.006178.575138.319221.528
Arcane Orb4.0520.00019.12752.15630.35281.009

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Harmony
mana_regen Mana 1083.74 382030.86 65.23% 352.51 8116.35 2.08%
Evocation Mana 54.46 59188.20 10.11% 1086.90 0.00 0.00%
Mana Gem Mana 2.75 17972.35 3.07% 6539.43 0.00 0.00%
Arcane Barrage Mana 50.36 126441.96 21.59% 2510.95 5276.57 4.01%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 64394.3 1960.36 2071.01 13326.7 32343.5 1084.1 65394.3
Usage Type Count Total Avg RPE APR
Harmony
arcane_blast Mana 0.0 6.7 3437.5 3384.3 0.6
arcane_explosion Mana 131.3 596360.1 4543.6 4544.7 2.5
arcane_orb Mana 12.7 5791.9 454.9 454.9 50.5
touch_of_the_magi Mana 6.2 15505.8 2499.2 2497.9 13.8

Statistics & Data Analysis

Fight Length
Harmony Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Harmony Damage Per Second
Count 1017
Mean 13576.09
Minimum 12563.81
Maximum 14821.55
Spread ( max - min ) 2257.75
Range [ ( max - min ) / 2 * 100% ] 8.32%
Standard Deviation 400.0597
5th Percentile 12980.14
95th Percentile 14249.95
( 95th Percentile - 5th Percentile ) 1269.82
Mean Distribution
Standard Deviation 12.5448
95.00% Confidence Interval ( 13551.50 - 13600.67 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3336
0.1 Scale Factor Error with Delta=300 1367
0.05 Scale Factor Error with Delta=300 5466
0.01 Scale Factor Error with Delta=300 136626
Priority Target DPS
Harmony Priority Target Damage Per Second
Count 1017
Mean 4740.51
Minimum 4039.64
Maximum 5704.64
Spread ( max - min ) 1665.00
Range [ ( max - min ) / 2 * 100% ] 17.56%
Standard Deviation 250.9721
5th Percentile 4348.99
95th Percentile 5161.93
( 95th Percentile - 5th Percentile ) 812.94
Mean Distribution
Standard Deviation 7.8698
95.00% Confidence Interval ( 4725.08 - 4755.93 )
Normalized 95.00% Confidence Interval ( 99.67% - 100.33% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10768
0.1 Scale Factor Error with Delta=300 538
0.05 Scale Factor Error with Delta=300 2151
0.01 Scale Factor Error with Delta=300 53770
DPS(e)
Harmony Damage Per Second (Effective)
Count 1017
Mean 13576.09
Minimum 12563.81
Maximum 14821.55
Spread ( max - min ) 2257.75
Range [ ( max - min ) / 2 * 100% ] 8.32%
Damage
Harmony Damage
Count 1017
Mean 4045690.20
Minimum 3088089.29
Maximum 4909426.59
Spread ( max - min ) 1821337.30
Range [ ( max - min ) / 2 * 100% ] 22.51%
DTPS
Harmony Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Harmony Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Harmony Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Harmony Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Harmony Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Harmony Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
HarmonyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Harmony Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.22 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
n 24.79 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 131.25 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 50.35 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.19 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
r 0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
t 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
u 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
v 2.87 use_items,if=buff.arcane_power.up
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
x 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkvwxpmpoooopoooopononoolpoounoonpmnpoooopoooopoooopmpooonopoooopjlpmpoonoopooooponooopmponooopooqjlpmponooopoonookvpoooopmupoooopoooopoojlnpmponooopoooopoonoopmpoonoopoooopjlpmponooonpooonopmpoooonpoooopoonjkvxpmpooonuopoonoolpoooonpmpoooonpoonoopoooopmpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat N am_spam Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Q flask Harmony 65394.3/65394: 100% mana
Pre precombat R food Harmony 65394.3/65394: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 65394.3/65394: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 64394.3/65394: 98% mana
0:01.261 aoe k arcane_power Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.261 shared_cds v use_items Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
0:01.261 shared_cds w potion Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
0:01.261 shared_cds x berserking Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.261 aoe p arcane_barrage Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.144 aoe m arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.027 aoe p arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.911 aoe o arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.796 aoe o arcane_explosion Fluffy_Pillow 64051.8/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.679 aoe o arcane_explosion Fluffy_Pillow 62706.6/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.559 aoe o arcane_explosion Fluffy_Pillow 63857.6/65394: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.441 aoe p arcane_barrage Fluffy_Pillow 62511.1/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.324 aoe o arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.208 aoe o arcane_explosion Fluffy_Pillow 64050.5/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.092 aoe o arcane_explosion Fluffy_Pillow 62706.6/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.975 aoe o arcane_explosion Fluffy_Pillow 61361.5/65394: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.858 aoe p arcane_barrage Fluffy_Pillow 60016.4/65394: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.741 aoe o arcane_explosion Fluffy_Pillow 63787.0/65394: 98% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.625 aoe n arcane_missiles Fluffy_Pillow 62443.2/65394: 95% mana bloodlust, arcane_charge, arcane_power, clearcasting, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.124 aoe o arcane_explosion Fluffy_Pillow 64403.7/65394: 98% mana bloodlust, arcane_charge, arcane_power, arcane_harmony(8), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.096 aoe n arcane_missiles Fluffy_Pillow 63174.9/65394: 97% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, arcane_harmony(8), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.555 aoe o arcane_explosion Fluffy_Pillow 65083.2/65394: 100% mana bloodlust, arcane_charge(2), arcane_harmony(15), crimson_chorus(2), potion_of_deathly_fixation
0:18.525 aoe o arcane_explosion Fluffy_Pillow 61351.8/65394: 94% mana bloodlust, arcane_charge(3), arcane_harmony(15), crimson_chorus(2), potion_of_deathly_fixation
0:19.497 aoe l rune_of_power Fluffy_Pillow 57623.1/65394: 88% mana bloodlust, arcane_charge(4), arcane_harmony(15), crimson_chorus(2), potion_of_deathly_fixation
0:20.470 aoe p arcane_barrage Fluffy_Pillow 58895.6/65394: 90% mana bloodlust, arcane_charge(4), rune_of_power, arcane_harmony(15), crimson_chorus(3), potion_of_deathly_fixation
0:21.443 aoe o arcane_explosion Fluffy_Pillow 62784.0/65394: 96% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.415 aoe o arcane_explosion Fluffy_Pillow 59055.2/65394: 90% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.385 shared_cds u use_mana_gem Harmony 55323.9/65394: 85% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.385 aoe n arcane_missiles Fluffy_Pillow 61863.3/65394: 95% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.896 aoe o arcane_explosion Fluffy_Pillow 63839.5/65394: 98% mana bloodlust, arcane_charge(2), rune_of_power, arcane_harmony(8), crimson_chorus(3), potion_of_deathly_fixation
0:25.867 aoe o arcane_explosion Fluffy_Pillow 60109.5/65394: 92% mana bloodlust, arcane_charge(3), rune_of_power, arcane_harmony(8), crimson_chorus(3), potion_of_deathly_fixation
0:26.840 aoe n arcane_missiles Fluffy_Pillow 56382.1/65394: 86% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, arcane_harmony(8), crimson_chorus(3)
0:28.431 aoe p arcane_barrage Fluffy_Pillow 58462.9/65394: 89% mana bloodlust, arcane_charge(4), rune_of_power, arcane_harmony(15), crimson_chorus(3)
0:29.403 aoe m arcane_orb Fluffy_Pillow 62350.0/65394: 95% mana bloodlust, rune_of_power, crimson_chorus(3)
0:30.374 aoe n arcane_missiles Fluffy_Pillow 63119.9/65394: 97% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:31.936 aoe p arcane_barrage Fluffy_Pillow 65162.8/65394: 100% mana bloodlust, arcane_charge(4), rune_of_power, arcane_harmony(8)
0:32.907 aoe o arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust
0:33.880 aoe o arcane_explosion Fluffy_Pillow 61666.9/65394: 94% mana bloodlust, arcane_charge
0:34.852 aoe o arcane_explosion Fluffy_Pillow 57938.1/65394: 89% mana bloodlust, arcane_charge(2)
0:35.823 aoe o arcane_explosion Fluffy_Pillow 54208.1/65394: 83% mana bloodlust, arcane_charge(3)
0:36.794 aoe p arcane_barrage Fluffy_Pillow 50478.0/65394: 77% mana bloodlust, arcane_charge(4)
0:37.765 aoe o arcane_explosion Fluffy_Pillow 54363.8/65394: 83% mana bloodlust
0:38.736 aoe o arcane_explosion Fluffy_Pillow 50633.7/65394: 77% mana bloodlust, arcane_charge
0:39.708 aoe o arcane_explosion Fluffy_Pillow 46905.0/65394: 72% mana bloodlust, arcane_charge(2)
0:40.679 aoe o arcane_explosion Fluffy_Pillow 43174.9/65394: 66% mana bloodlust, arcane_charge(3)
0:41.650 aoe p arcane_barrage Fluffy_Pillow 39444.9/65394: 60% mana arcane_charge(4)
0:42.911 aoe o arcane_explosion Fluffy_Pillow 43709.9/65394: 67% mana
0:44.172 aoe o arcane_explosion Fluffy_Pillow 40359.2/65394: 62% mana arcane_charge
0:45.435 aoe o arcane_explosion Fluffy_Pillow 37011.0/65394: 57% mana arcane_charge(2)
0:46.696 aoe o arcane_explosion Fluffy_Pillow 33660.3/65394: 51% mana arcane_charge(3)
0:47.957 aoe p arcane_barrage Fluffy_Pillow 30309.5/65394: 46% mana arcane_charge(4)
0:49.220 aoe m arcane_orb Fluffy_Pillow 34577.1/65394: 53% mana
0:50.666 aoe p arcane_barrage Fluffy_Pillow 35968.3/65394: 55% mana arcane_charge(4)
0:51.928 aoe o arcane_explosion Fluffy_Pillow 40234.7/65394: 62% mana
0:53.189 aoe o arcane_explosion Fluffy_Pillow 36883.9/65394: 56% mana arcane_charge
0:54.450 aoe o arcane_explosion Fluffy_Pillow 33533.2/65394: 51% mana arcane_charge(2)
0:55.711 aoe n arcane_missiles Fluffy_Pillow 30182.4/65394: 46% mana arcane_charge(3), clearcasting
0:57.681 aoe o arcane_explosion Fluffy_Pillow 32758.9/65394: 50% mana arcane_charge(3), arcane_harmony(8)
0:58.944 aoe p arcane_barrage Fluffy_Pillow 29410.8/65394: 45% mana arcane_charge(4), arcane_harmony(8)
1:00.205 aoe o arcane_explosion Fluffy_Pillow 33675.8/65394: 51% mana
1:01.466 aoe o arcane_explosion Fluffy_Pillow 30325.1/65394: 46% mana arcane_charge
1:02.727 aoe o arcane_explosion Fluffy_Pillow 26974.3/65394: 41% mana arcane_charge(2), crimson_chorus
1:03.990 aoe o arcane_explosion Fluffy_Pillow 23626.2/65394: 36% mana arcane_charge(3), crimson_chorus
1:05.251 aoe p arcane_barrage Fluffy_Pillow 20275.4/65394: 31% mana arcane_charge(4), crimson_chorus
1:06.513 aoe j touch_of_the_magi Fluffy_Pillow 24541.7/65394: 38% mana crimson_chorus
1:07.776 aoe l rune_of_power Fluffy_Pillow 23693.6/65394: 36% mana arcane_charge(4), crimson_chorus
1:09.039 aoe p arcane_barrage Fluffy_Pillow 25345.4/65394: 39% mana arcane_charge(4), rune_of_power, crimson_chorus
1:10.300 aoe m arcane_orb Fluffy_Pillow 29610.5/65394: 45% mana rune_of_power, crimson_chorus
1:11.562 aoe p arcane_barrage Fluffy_Pillow 30761.0/65394: 47% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:12.823 aoe o arcane_explosion Fluffy_Pillow 35026.0/65394: 54% mana rune_of_power, crimson_chorus(2)
1:14.083 aoe o arcane_explosion Fluffy_Pillow 31674.0/65394: 48% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:15.344 aoe n arcane_missiles Fluffy_Pillow 28323.2/65394: 43% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2)
1:17.278 aoe o arcane_explosion Fluffy_Pillow 30852.7/65394: 47% mana arcane_charge(2), rune_of_power, arcane_harmony(8), crimson_chorus(2)
1:18.540 aoe o arcane_explosion Fluffy_Pillow 27503.2/65394: 42% mana arcane_charge(3), rune_of_power, arcane_harmony(8), crimson_chorus(2)
1:19.801 aoe p arcane_barrage Fluffy_Pillow 24152.4/65394: 37% mana arcane_charge(4), rune_of_power, arcane_harmony(8), crimson_chorus(2)
1:21.062 aoe o arcane_explosion Fluffy_Pillow 28417.5/65394: 43% mana crimson_chorus(2)
1:22.323 aoe o arcane_explosion Fluffy_Pillow 25066.7/65394: 38% mana arcane_charge, crimson_chorus(3)
1:23.586 aoe o arcane_explosion Fluffy_Pillow 21718.6/65394: 33% mana arcane_charge(2), crimson_chorus(3)
1:24.849 aoe o arcane_explosion Fluffy_Pillow 18370.4/65394: 28% mana arcane_charge(3), crimson_chorus(3)
1:26.110 aoe p arcane_barrage Fluffy_Pillow 15019.7/65394: 23% mana arcane_charge(4), crimson_chorus(3)
1:27.372 aoe o arcane_explosion Fluffy_Pillow 19286.0/65394: 29% mana crimson_chorus(3)
1:28.633 aoe n arcane_missiles Fluffy_Pillow 15935.2/65394: 24% mana arcane_charge, clearcasting, crimson_chorus(3)
1:30.634 aoe o arcane_explosion Fluffy_Pillow 18552.3/65394: 28% mana arcane_charge, arcane_harmony(8), crimson_chorus(3)
1:31.895 aoe o arcane_explosion Fluffy_Pillow 15201.6/65394: 23% mana arcane_charge(2), arcane_harmony(8)
1:33.158 aoe o arcane_explosion Fluffy_Pillow 11853.4/65394: 18% mana arcane_charge(3), arcane_harmony(8)
1:34.420 aoe p arcane_barrage Fluffy_Pillow 8504.0/65394: 13% mana arcane_charge(4), arcane_harmony(8)
1:35.682 aoe m arcane_orb Fluffy_Pillow 12770.3/65394: 20% mana
1:36.944 aoe p arcane_barrage Fluffy_Pillow 13920.8/65394: 21% mana arcane_charge(4)
1:38.206 aoe o arcane_explosion Fluffy_Pillow 18187.2/65394: 28% mana
1:39.468 aoe n arcane_missiles Fluffy_Pillow 14837.7/65394: 23% mana arcane_charge, clearcasting
1:41.365 aoe o arcane_explosion Fluffy_Pillow 17318.8/65394: 26% mana arcane_charge, arcane_harmony(8)
1:42.627 aoe o arcane_explosion Fluffy_Pillow 13969.3/65394: 21% mana arcane_charge(2), arcane_harmony(8)
1:43.888 aoe o arcane_explosion Fluffy_Pillow 10618.6/65394: 16% mana arcane_charge(3), arcane_harmony(8)
1:45.150 aoe p arcane_barrage Fluffy_Pillow 7269.1/65394: 11% mana arcane_charge(4), arcane_harmony(8)
1:46.412 aoe o arcane_explosion Fluffy_Pillow 11535.5/65394: 18% mana
1:47.674 aoe o arcane_explosion Fluffy_Pillow 8186.0/65394: 13% mana arcane_charge
1:48.934 aoe q evocation Harmony 4833.9/65394: 7% mana arcane_charge(2)
1:53.129 aoe j touch_of_the_magi Fluffy_Pillow 60384.0/65394: 92% mana arcane_charge(2)
1:54.391 aoe l rune_of_power Fluffy_Pillow 59534.6/65394: 91% mana arcane_charge(4)
1:55.652 aoe p arcane_barrage Fluffy_Pillow 61183.8/65394: 94% mana arcane_charge(4), rune_of_power
1:56.912 aoe m arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power
1:58.172 aoe p arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), rune_of_power
1:59.434 aoe o arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power
2:00.694 aoe n arcane_missiles Fluffy_Pillow 62042.2/65394: 95% mana arcane_charge, clearcasting, rune_of_power
2:02.630 aoe o arcane_explosion Fluffy_Pillow 64574.3/65394: 99% mana arcane_charge, rune_of_power, arcane_harmony(8), crimson_chorus
2:03.891 aoe o arcane_explosion Fluffy_Pillow 61223.5/65394: 94% mana arcane_charge(2), rune_of_power, arcane_harmony(8), crimson_chorus
2:05.152 aoe o arcane_explosion Fluffy_Pillow 57872.8/65394: 88% mana arcane_charge(3), rune_of_power, arcane_harmony(8), crimson_chorus
2:06.413 aoe p arcane_barrage Fluffy_Pillow 54522.0/65394: 83% mana arcane_charge(4), rune_of_power, arcane_harmony(8), crimson_chorus
2:07.675 aoe o arcane_explosion Fluffy_Pillow 58788.3/65394: 90% mana crimson_chorus
2:08.937 aoe o arcane_explosion Fluffy_Pillow 55438.9/65394: 85% mana arcane_charge, crimson_chorus
2:10.200 aoe n arcane_missiles Fluffy_Pillow 52090.8/65394: 80% mana arcane_charge(2), clearcasting, crimson_chorus
2:12.105 aoe o arcane_explosion Fluffy_Pillow 54582.3/65394: 83% mana arcane_charge(2), arcane_harmony(8), crimson_chorus(2)
2:13.364 aoe o arcane_explosion Fluffy_Pillow 51228.9/65394: 78% mana arcane_charge(3), arcane_harmony(8), crimson_chorus(2)
2:14.624 aoe k arcane_power Fluffy_Pillow 47876.8/65394: 73% mana arcane_charge(4), arcane_harmony(8), crimson_chorus(2)
2:14.624 shared_cds v use_items Fluffy_Pillow 47876.8/65394: 73% mana arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(2)
2:14.624 aoe p arcane_barrage Fluffy_Pillow 47876.8/65394: 73% mana arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(2), gladiators_badge
2:15.886 aoe o arcane_explosion Fluffy_Pillow 52143.2/65394: 80% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.148 aoe o arcane_explosion Fluffy_Pillow 51293.7/65394: 78% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.408 aoe o arcane_explosion Fluffy_Pillow 50441.7/65394: 77% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.669 aoe o arcane_explosion Fluffy_Pillow 49590.9/65394: 76% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.931 aoe p arcane_barrage Fluffy_Pillow 48741.4/65394: 75% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:22.193 aoe m arcane_orb Fluffy_Pillow 53007.8/65394: 81% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.453 shared_cds u use_mana_gem Harmony 54405.7/65394: 83% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.453 aoe p arcane_barrage Fluffy_Pillow 60945.1/65394: 93% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.715 aoe o arcane_explosion Fluffy_Pillow 65211.5/65394: 100% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:25.978 aoe o arcane_explosion Fluffy_Pillow 64363.3/65394: 98% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:27.240 aoe o arcane_explosion Fluffy_Pillow 63513.9/65394: 97% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:28.502 aoe o arcane_explosion Fluffy_Pillow 62664.4/65394: 96% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:29.764 aoe p arcane_barrage Fluffy_Pillow 61815.0/65394: 95% mana arcane_charge(4), crimson_chorus(3)
2:31.025 aoe o arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana crimson_chorus(3)
2:32.287 aoe o arcane_explosion Fluffy_Pillow 62044.8/65394: 95% mana arcane_charge
2:33.547 aoe o arcane_explosion Fluffy_Pillow 58692.8/65394: 90% mana arcane_charge(2)
2:34.809 aoe o arcane_explosion Fluffy_Pillow 55343.3/65394: 85% mana arcane_charge(3)
2:36.069 aoe p arcane_barrage Fluffy_Pillow 51991.3/65394: 80% mana arcane_charge(4)
2:37.329 aoe o arcane_explosion Fluffy_Pillow 56255.0/65394: 86% mana
2:38.588 aoe o arcane_explosion Fluffy_Pillow 52901.6/65394: 81% mana arcane_charge
2:39.846 aoe j touch_of_the_magi Fluffy_Pillow 49546.9/65394: 76% mana arcane_charge(2), clearcasting
2:41.106 aoe l rune_of_power Fluffy_Pillow 48694.9/65394: 74% mana arcane_charge(4), clearcasting
2:42.365 aoe n arcane_missiles Fluffy_Pillow 50341.5/65394: 77% mana arcane_charge(4), clearcasting, rune_of_power
2:44.256 aoe p arcane_barrage Fluffy_Pillow 52814.7/65394: 81% mana arcane_charge(4), rune_of_power, arcane_harmony(8)
2:45.519 aoe m arcane_orb Fluffy_Pillow 57082.3/65394: 87% mana rune_of_power
2:46.781 aoe p arcane_barrage Fluffy_Pillow 58232.9/65394: 89% mana arcane_charge(4), rune_of_power
2:48.043 aoe o arcane_explosion Fluffy_Pillow 62499.2/65394: 96% mana rune_of_power
2:49.306 aoe n arcane_missiles Fluffy_Pillow 59151.1/65394: 90% mana arcane_charge, clearcasting, rune_of_power
2:51.351 aoe o arcane_explosion Fluffy_Pillow 61825.7/65394: 95% mana arcane_charge, rune_of_power, arcane_harmony(8)
2:52.611 aoe o arcane_explosion Fluffy_Pillow 58473.6/65394: 89% mana arcane_charge(2), rune_of_power, arcane_harmony(8)
2:53.875 aoe o arcane_explosion Fluffy_Pillow 55126.8/65394: 84% mana arcane_charge(3), rune_of_power, arcane_harmony(8)
2:55.137 aoe p arcane_barrage Fluffy_Pillow 51777.3/65394: 79% mana arcane_charge(4), arcane_harmony(8)
2:56.398 aoe o arcane_explosion Fluffy_Pillow 56042.4/65394: 86% mana
2:57.660 aoe o arcane_explosion Fluffy_Pillow 52692.9/65394: 81% mana arcane_charge
2:58.920 aoe o arcane_explosion Fluffy_Pillow 49340.8/65394: 75% mana arcane_charge(2)
3:00.182 aoe o arcane_explosion Fluffy_Pillow 45991.4/65394: 70% mana arcane_charge(3)
3:01.444 aoe p arcane_barrage Fluffy_Pillow 42641.9/65394: 65% mana arcane_charge(4)
3:02.705 aoe o arcane_explosion Fluffy_Pillow 46907.0/65394: 72% mana crimson_chorus
3:03.967 aoe o arcane_explosion Fluffy_Pillow 43557.5/65394: 67% mana arcane_charge, crimson_chorus
3:05.228 aoe n arcane_missiles Fluffy_Pillow 40206.8/65394: 61% mana arcane_charge(2), clearcasting, crimson_chorus
3:07.200 aoe o arcane_explosion Fluffy_Pillow 42785.9/65394: 65% mana arcane_charge(2), arcane_harmony(8), crimson_chorus
3:08.460 aoe o arcane_explosion Fluffy_Pillow 39433.8/65394: 60% mana arcane_charge(3), arcane_harmony(8), crimson_chorus
3:09.723 aoe p arcane_barrage Fluffy_Pillow 36085.7/65394: 55% mana arcane_charge(4), arcane_harmony(8), crimson_chorus
3:10.984 aoe m arcane_orb Fluffy_Pillow 40350.7/65394: 62% mana crimson_chorus
3:12.245 aoe p arcane_barrage Fluffy_Pillow 41500.0/65394: 63% mana arcane_charge(4), crimson_chorus(2)
3:13.505 aoe o arcane_explosion Fluffy_Pillow 45763.7/65394: 70% mana crimson_chorus(2)
3:14.766 aoe o arcane_explosion Fluffy_Pillow 42412.9/65394: 65% mana arcane_charge, crimson_chorus(2)
3:16.027 aoe n arcane_missiles Fluffy_Pillow 39062.2/65394: 60% mana arcane_charge(2), clearcasting, crimson_chorus(2)
3:17.893 aoe o arcane_explosion Fluffy_Pillow 41502.7/65394: 63% mana arcane_charge(2), arcane_harmony(7), crimson_chorus(2)
3:19.157 aoe o arcane_explosion Fluffy_Pillow 38155.8/65394: 58% mana arcane_charge(3), arcane_harmony(8), crimson_chorus(2)
3:20.418 aoe p arcane_barrage Fluffy_Pillow 34805.1/65394: 53% mana arcane_charge(4), arcane_harmony(8), crimson_chorus(2)
3:21.679 aoe o arcane_explosion Fluffy_Pillow 39070.1/65394: 60% mana crimson_chorus(2)
3:22.941 aoe o arcane_explosion Fluffy_Pillow 35720.7/65394: 55% mana arcane_charge, crimson_chorus(3)
3:24.202 aoe o arcane_explosion Fluffy_Pillow 32369.9/65394: 49% mana arcane_charge(2), crimson_chorus(3)
3:25.464 aoe o arcane_explosion Fluffy_Pillow 29020.4/65394: 44% mana arcane_charge(3), crimson_chorus(3)
3:26.725 aoe p arcane_barrage Fluffy_Pillow 25669.7/65394: 39% mana arcane_charge(4), crimson_chorus(3)
3:27.985 aoe j touch_of_the_magi Fluffy_Pillow 29933.4/65394: 46% mana crimson_chorus(3)
3:29.247 aoe l rune_of_power Fluffy_Pillow 29084.0/65394: 44% mana arcane_charge(4), crimson_chorus(3)
3:30.508 aoe p arcane_barrage Fluffy_Pillow 30733.2/65394: 47% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:31.770 aoe m arcane_orb Fluffy_Pillow 34999.5/65394: 54% mana rune_of_power, crimson_chorus(3)
3:33.031 aoe p arcane_barrage Fluffy_Pillow 36148.8/65394: 55% mana arcane_charge(4), rune_of_power
3:34.291 aoe o arcane_explosion Fluffy_Pillow 40412.5/65394: 62% mana rune_of_power
3:35.553 aoe n arcane_missiles Fluffy_Pillow 37063.0/65394: 57% mana arcane_charge, clearcasting, rune_of_power
3:37.519 aoe o arcane_explosion Fluffy_Pillow 39634.3/65394: 61% mana arcane_charge, rune_of_power, arcane_harmony(8)
3:38.780 aoe o arcane_explosion Fluffy_Pillow 36283.6/65394: 55% mana arcane_charge(2), rune_of_power, arcane_harmony(8)
3:40.040 aoe o arcane_explosion Fluffy_Pillow 32931.5/65394: 50% mana arcane_charge(3), rune_of_power, arcane_harmony(8)
3:41.300 aoe n arcane_missiles Fluffy_Pillow 29579.4/65394: 45% mana arcane_charge(4), clearcasting, rune_of_power, arcane_harmony(8)
3:43.342 aoe p arcane_barrage Fluffy_Pillow 32250.1/65394: 49% mana arcane_charge(4), arcane_harmony(15)
3:44.603 aoe o arcane_explosion Fluffy_Pillow 36515.2/65394: 56% mana
3:45.865 aoe o arcane_explosion Fluffy_Pillow 33165.7/65394: 51% mana arcane_charge
3:47.126 aoe o arcane_explosion Fluffy_Pillow 29815.0/65394: 46% mana arcane_charge(2)
3:48.388 aoe n arcane_missiles Fluffy_Pillow 26465.5/65394: 40% mana arcane_charge(3), clearcasting
3:50.411 aoe o arcane_explosion Fluffy_Pillow 29111.4/65394: 45% mana arcane_charge(3), arcane_harmony(8)
3:51.672 aoe p arcane_barrage Fluffy_Pillow 25760.6/65394: 39% mana arcane_charge(4), arcane_harmony(8)
3:52.934 aoe m arcane_orb Fluffy_Pillow 30026.9/65394: 46% mana
3:54.197 aoe p arcane_barrage Fluffy_Pillow 31178.8/65394: 48% mana arcane_charge(4)
3:55.458 aoe o arcane_explosion Fluffy_Pillow 35443.8/65394: 54% mana
3:56.719 aoe o arcane_explosion Fluffy_Pillow 32093.0/65394: 49% mana arcane_charge
3:57.982 aoe o arcane_explosion Fluffy_Pillow 28744.9/65394: 44% mana arcane_charge(2)
3:59.244 aoe o arcane_explosion Fluffy_Pillow 25395.5/65394: 39% mana arcane_charge(3)
4:00.505 aoe n arcane_missiles Fluffy_Pillow 22044.7/65394: 34% mana arcane_charge(4), clearcasting
4:02.434 aoe p arcane_barrage Fluffy_Pillow 24567.6/65394: 38% mana arcane_charge(4), arcane_harmony(8), crimson_chorus
4:03.696 aoe o arcane_explosion Fluffy_Pillow 28833.9/65394: 44% mana crimson_chorus
4:04.956 aoe o arcane_explosion Fluffy_Pillow 25481.9/65394: 39% mana arcane_charge, crimson_chorus
4:06.217 aoe o arcane_explosion Fluffy_Pillow 22131.1/65394: 34% mana arcane_charge(2), crimson_chorus
4:07.479 aoe o arcane_explosion Fluffy_Pillow 18781.7/65394: 29% mana arcane_charge(3), crimson_chorus
4:08.740 aoe p arcane_barrage Fluffy_Pillow 15430.9/65394: 24% mana arcane_charge(4), crimson_chorus
4:10.002 aoe o arcane_explosion Fluffy_Pillow 19697.2/65394: 30% mana crimson_chorus
4:11.264 aoe o arcane_explosion Fluffy_Pillow 16347.8/65394: 25% mana arcane_charge, crimson_chorus
4:12.526 aoe n arcane_missiles Fluffy_Pillow 12998.3/65394: 20% mana arcane_charge(2), clearcasting, crimson_chorus(2)
4:14.366 aoe j touch_of_the_magi Fluffy_Pillow 15404.8/65394: 24% mana arcane_charge(2), arcane_harmony(7), crimson_chorus(2)
4:15.626 aoe k arcane_power Fluffy_Pillow 14552.8/65394: 22% mana arcane_charge(4), arcane_harmony(8), crimson_chorus(2)
4:15.626 shared_cds v use_items Fluffy_Pillow 14552.8/65394: 22% mana arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(2)
4:15.626 shared_cds x berserking Fluffy_Pillow 14552.8/65394: 22% mana arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(2), gladiators_badge
4:15.626 aoe p arcane_barrage Fluffy_Pillow 14552.8/65394: 22% mana berserking, arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(2), gladiators_badge
4:16.774 aoe m arcane_orb Fluffy_Pillow 18670.0/65394: 29% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.922 aoe p arcane_barrage Fluffy_Pillow 19921.5/65394: 30% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.071 aoe o arcane_explosion Fluffy_Pillow 24040.0/65394: 37% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.218 aoe o arcane_explosion Fluffy_Pillow 23040.1/65394: 35% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.365 aoe o arcane_explosion Fluffy_Pillow 22040.3/65394: 34% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.512 aoe n arcane_missiles Fluffy_Pillow 21040.4/65394: 32% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.388 shared_cds u use_mana_gem Harmony 23494.0/65394: 36% mana berserking, arcane_charge(3), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(3), gladiators_badge
4:24.388 aoe o arcane_explosion Fluffy_Pillow 30033.4/65394: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(3), gladiators_badge
4:25.536 aoe p arcane_barrage Fluffy_Pillow 29034.9/65394: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power, arcane_harmony(8), crimson_chorus(3), gladiators_badge
4:26.683 aoe o arcane_explosion Fluffy_Pillow 33150.8/65394: 51% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.832 aoe o arcane_explosion Fluffy_Pillow 32153.6/65394: 49% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
4:29.093 aoe n arcane_missiles Fluffy_Pillow 31302.8/65394: 48% mana arcane_charge(2), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
4:31.097 aoe o arcane_explosion Fluffy_Pillow 33923.8/65394: 52% mana arcane_charge(2), arcane_harmony(8), crimson_chorus(3)
4:32.359 aoe o arcane_explosion Fluffy_Pillow 30574.4/65394: 47% mana arcane_charge(3), arcane_harmony(8)
4:33.620 aoe l rune_of_power Fluffy_Pillow 27223.6/65394: 42% mana arcane_charge(4), arcane_harmony(8)
4:34.880 aoe p arcane_barrage Fluffy_Pillow 28871.6/65394: 44% mana arcane_charge(4), rune_of_power, arcane_harmony(8)
4:36.141 aoe o arcane_explosion Fluffy_Pillow 33136.6/65394: 51% mana rune_of_power
4:37.402 aoe o arcane_explosion Fluffy_Pillow 29785.8/65394: 46% mana arcane_charge, rune_of_power
4:38.663 aoe o arcane_explosion Fluffy_Pillow 26435.1/65394: 40% mana arcane_charge(2), rune_of_power
4:39.927 aoe o arcane_explosion Fluffy_Pillow 23088.2/65394: 35% mana arcane_charge(3), rune_of_power
4:41.187 aoe n arcane_missiles Fluffy_Pillow 19736.2/65394: 30% mana arcane_charge(4), clearcasting, rune_of_power
4:43.073 aoe p arcane_barrage Fluffy_Pillow 22202.8/65394: 34% mana arcane_charge(4), rune_of_power, arcane_harmony(7)
4:44.335 aoe m arcane_orb Fluffy_Pillow 26469.2/65394: 40% mana rune_of_power, arcane_harmony
4:45.595 aoe p arcane_barrage Fluffy_Pillow 27617.1/65394: 42% mana arcane_charge(4), rune_of_power, arcane_harmony
4:46.857 aoe o arcane_explosion Fluffy_Pillow 31883.4/65394: 49% mana rune_of_power
4:48.118 aoe o arcane_explosion Fluffy_Pillow 28532.7/65394: 44% mana arcane_charge
4:49.379 aoe o arcane_explosion Fluffy_Pillow 25181.9/65394: 39% mana arcane_charge(2)
4:50.642 aoe o arcane_explosion Fluffy_Pillow 21833.8/65394: 33% mana arcane_charge(3)
4:51.903 aoe n arcane_missiles Fluffy_Pillow 18483.0/65394: 28% mana arcane_charge(4), clearcasting
4:53.860 aoe p arcane_barrage Fluffy_Pillow 21042.5/65394: 32% mana arcane_charge(4), arcane_harmony(8)
4:55.121 aoe o arcane_explosion Fluffy_Pillow 25307.6/65394: 39% mana
4:56.382 aoe o arcane_explosion Fluffy_Pillow 21956.8/65394: 34% mana arcane_charge
4:57.645 aoe n arcane_missiles Fluffy_Pillow 18608.7/65394: 28% mana arcane_charge(2), clearcasting
4:59.520 aoe o arcane_explosion Fluffy_Pillow 21060.9/65394: 32% mana arcane_charge(2), arcane_harmony(7)
5:00.780 aoe o arcane_explosion Fluffy_Pillow 17708.9/65394: 27% mana arcane_charge(3), arcane_harmony(8)
5:02.041 aoe p arcane_barrage Fluffy_Pillow 14358.1/65394: 22% mana arcane_charge(4), arcane_harmony(8)
5:03.302 aoe o arcane_explosion Fluffy_Pillow 18623.1/65394: 28% mana crimson_chorus
5:04.564 aoe o arcane_explosion Fluffy_Pillow 15273.7/65394: 23% mana arcane_charge, crimson_chorus
5:05.826 aoe o arcane_explosion Fluffy_Pillow 11924.2/65394: 18% mana arcane_charge(2), crimson_chorus
5:07.087 aoe o arcane_explosion Fluffy_Pillow 8573.5/65394: 13% mana arcane_charge(3), crimson_chorus
5:08.348 aoe p arcane_barrage Fluffy_Pillow 5222.7/65394: 8% mana arcane_charge(4), crimson_chorus
5:09.610 aoe m arcane_orb Fluffy_Pillow 9489.1/65394: 15% mana crimson_chorus
5:10.872 aoe p arcane_barrage Fluffy_Pillow 10639.6/65394: 16% mana arcane_charge(4), crimson_chorus
5:12.133 aoe o arcane_explosion Fluffy_Pillow 14904.6/65394: 23% mana crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 65394 65394 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 19.24% 19.24% 635
Versatility 7.97% 7.97% 319
Mana Regen 1308 1308 0
Mastery 30.79% 30.79% 618
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Harmony }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Harmony"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6649/6650/6758/6926/1532,ilevel=235,enchant_id=6168
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=635
# gear_mastery_rating=618
# gear_versatility_rating=319
# gear_armor=369

SiphonStorm : 13744 dps, 3894 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13743.9 13743.9 21.3 / 0.155% 1285.9 / 9.4% 6.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
2101.3 2031.0 Mana 0.00% 51.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
SiphonStorm 13744
Arcane Barrage 5617 40.9% 58.2 5.15sec 28790 23974 Direct 290.6 4831 9865 5768 18.6%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.21 290.61 0.00 0.00 1.2009 0.0000 1675825.57 1675825.57 0.00% 23973.59 23973.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.38% 236.48 183 296 4830.61 1044 19360 4832.97 4354 5311 1142145 1142145 0.00%
crit 18.62% 54.12 30 83 9865.41 2967 38720 9861.20 7238 13307 533680 533680 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [s]:58.14
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [w]:0.07
Arcane Blast 0 0.0% 0.0 1.59sec 1827 1040 Direct 0.0 1637 2208 1827 33.3%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.03 0.03 0.00 0.00 1.7712 0.0000 59.29 59.29 0.00% 1040.21 1040.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.67% 0.02 0 2 1637.14 916 2296 26.50 0 2296 35 35 0.00%
crit 33.33% 0.01 0 1 2207.53 1831 3212 23.88 0 3212 24 24 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [v]:0.03
Arcane Explosion 6131 44.6% 157.9 1.87sec 11590 9682 Direct 789.6 1942 3980 2319 18.5%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 157.92 789.59 0.00 0.00 1.1972 0.0000 1830319.03 1830319.03 0.00% 9681.51 9681.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.52% 643.70 515 794 1942.17 1391 4207 1942.13 1850 2057 1249922 1249922 0.00%
crit 18.48% 145.88 90 214 3979.57 2782 8414 3978.94 3489 4490 580397 580397 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [r]:157.94
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1159) 0.0% (8.4%) 13.5 22.76sec 25574 21170

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.52 0.00 0.00 0.00 1.2081 0.0000 0.00 0.00 0.00% 21169.55 21169.55

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:13.51
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [u]:0.02
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 1159 8.4% 67.5 22.76sec 5122 0 Direct 67.5 4260 8762 5123 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.50 67.50 0.00 0.00 0.0000 0.0000 345741.01 345741.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 54.55 37 76 4260.45 2749 8315 4268.32 3710 4944 232365 232365 0.00%
crit 19.19% 12.95 3 25 8762.06 5498 16629 8762.05 6106 12263 113376 113376 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.5%) 14.6 1.73sec 1377 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.5% 14.6 1.73sec 1377 0 Direct 14.6 1137 2276 1376 21.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.57 14.57 0.00 0.00 0.0000 0.0000 20064.78 20064.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.93% 11.50 5 19 1136.91 1117 1184 1137.02 1117 1184 13077 13077 0.00%
crit 21.07% 3.07 0 11 2276.45 2233 2367 2190.31 0 2367 6988 6988 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 37 0.3% 20.4 14.46sec 550 0 Direct 20.4 464 928 549 18.4%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.35 20.35 0.00 0.00 0.0000 0.0000 11186.00 11186.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.64% 16.62 7 28 464.38 453 481 464.44 455 477 7718 7718 0.00%
crit 18.36% 3.74 0 10 928.18 907 961 906.89 0 961 3468 3468 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (17) 0.0% (0.1%) 1.0 0.00sec 4964 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 124  / 17 0.1% 93.0 1.25sec 53 42 Direct 93.0 44 89 53 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2644 0.0000 4964.45 4964.45 0.00% 42.22 42.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.02% 74.42 59 85 44.42 30 57 44.42 43 46 3305 3305 0.00%
crit 19.98% 18.58 8 34 89.30 59 113 89.26 75 102 1659 1659 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (714) 0.0% (5.2%) 6.2 51.72sec 34348 27234

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 0.00 0.00 0.00 1.2613 0.0000 0.00 0.00 0.00% 27233.86 27233.86

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:0.97
  • if_expr:runeforge.siphon_storm.equipped&prev_gcd.1.evocation
    aoe
    [n]:5.25
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 714 5.2% 6.2 51.66sec 34348 0 Direct 30.9 6899 0 6899 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 30.86 0.00 0.00 0.0000 0.0000 212778.15 212778.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.86 25 35 6899.09 1002 38481 6896.51 5152 8636 212778 212778 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17046.64
  • base_dd_max:17046.64
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
SiphonStorm
Arcane Power 2.8 127.94sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.43
  • if_expr:runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
    aoe
    [o]:0.41
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 255.89sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 2.9 136.29sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 12.05 0.00 2.9836 0.7051 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:SiphonStorm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [l]:0.77
  • if_expr:time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
    aoe
    [m]:0.51
  • if_expr:time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
  • interrupt_if_expr:buff.siphon_storm.stack=buff.siphon_storm.max_stack
    aoe
    [t]:0.63
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:SiphonStorm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:SiphonStorm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 49.94sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2136 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.6 129.44sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:SiphonStorm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [x]:2.65
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.0 189.1 5.1sec 1.2sec 3.8sec 75.49% 0.00% 31.0 (32.1) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 11.8s
  • trigger_min/max:0.0s / 6.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s

Stack Uptimes

  • arcane_charge_1:21.06%
  • arcane_charge_2:16.22%
  • arcane_charge_3:16.02%
  • arcane_charge_4:22.19%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 127.9sec 127.9sec 14.7sec 13.98% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 131.6s
  • trigger_min/max:120.2s / 131.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.98%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 255.7sec 255.7sec 11.7sec 7.17% 17.49% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:245.7s / 257.1s
  • trigger_min/max:245.7s / 257.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.17%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.9 0.1 11.5sec 11.5sec 1.9sec 16.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.86%
  • clearcasting_2:0.17%
  • clearcasting_3:0.11%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 61.3sec 61.3sec 28.6sec 51.27% 0.00% 0.0 (0.0) 4.8

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.4s
  • trigger_min/max:60.0s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.70%
  • crimson_chorus_2:17.09%
  • crimson_chorus_3:16.49%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.9 0.0 134.6sec 134.6sec 4.5sec 2.85% 0.00% 8.3 (8.3) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:98.8s / 160.6s
  • trigger_min/max:98.8s / 160.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • evocation_1:2.85%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.8 0.0 127.9sec 127.9sec 14.7sec 13.98% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:120.2s / 131.6s
  • trigger_min/max:120.2s / 131.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:13.98%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.13% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.9s / 53.4s
  • trigger_min/max:13.9s / 53.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.13%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Siphon Storm 2.9 16.1 124.7sec 11.5sec 31.1sec 30.26% 0.00% 1.7 (1.7) 2.6

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_siphon_storm
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.5s / 160.6s
  • trigger_min/max:0.8s / 156.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.0s

Stack Uptimes

  • siphon_storm_1:0.54%
  • siphon_storm_2:0.53%
  • siphon_storm_3:0.53%
  • siphon_storm_4:0.53%
  • siphon_storm_5:0.52%
  • siphon_storm_6:27.61%

Spelldata

  • id:332934
  • name:Siphon Storm
  • tooltip:Intellect increased by {$s1=2}%
  • description:{$@spelldesc332928=Evocation grants {$332929s1=1} $LArcane Charge:Charges;, and while channeling Evocation, your Intellect is increased by {$332934s1=2}% every $12051t2 sec. Lasts {$332934d=30 seconds}.}
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.01% 0.00% 2.99%
Arcane Barrage Arcane Charge 2 0.04% 0.00% 4.08%
Arcane Barrage Arcane Charge 3 0.07% 0.00% 3.85%
Arcane Barrage Arcane Charge 4 99.88% 93.88% 100.00%
Arcane Blast Arcane Charge 0 1.18% 0.00% 100.00%
Arcane Blast Arcane Charge 1 1.13% 0.00% 100.00%
Arcane Blast Arcane Charge 2 0.25% 0.00% 50.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 5.15% 1.25% 9.77% 1.2s 0.0s 5.8s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation22.7620.00070.60671.34343.88289.972
Rune of Power5.6750.03422.32336.23418.91342.464
Touch of the Magi4.5800.00015.75829.64217.36141.194
Arcane Power5.5480.23411.61216.0576.71518.393
Arcane Barrage2.7280.0029.253159.833124.897193.147
Arcane Orb2.6990.0009.28336.81527.61049.128

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
SiphonStorm
mana_regen Mana 511.77 365744.92 60.29% 714.66 24318.87 6.23%
Evocation Mana 90.40 83612.44 13.78% 924.91 18208.76 17.88%
Mana Gem Mana 2.65 17351.96 2.86% 6539.43 0.00 0.00%
Arcane Barrage Mana 58.21 139901.68 23.06% 2403.47 12287.85 8.07%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 65394.3 2030.99 2101.26 54621.4 44404.7 1204.7 65394.3
Usage Type Count Total Avg RPE APR
SiphonStorm
arcane_blast Mana 0.0 78.5 2458.3 2420.3 0.8
arcane_explosion Mana 157.9 605922.1 3836.5 3837.0 3.0
arcane_orb Mana 13.5 6063.6 448.4 448.5 57.0
touch_of_the_magi Mana 6.2 15465.9 2497.9 2496.6 13.8

Statistics & Data Analysis

Fight Length
SiphonStorm Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
SiphonStorm Damage Per Second
Count 1017
Mean 13743.86
Minimum 12902.11
Maximum 14840.81
Spread ( max - min ) 1938.70
Range [ ( max - min ) / 2 * 100% ] 7.05%
Standard Deviation 346.8216
5th Percentile 13224.10
95th Percentile 14338.57
( 95th Percentile - 5th Percentile ) 1114.47
Mean Distribution
Standard Deviation 10.8754
95.00% Confidence Interval ( 13722.55 - 13765.18 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2447
0.1 Scale Factor Error with Delta=300 1027
0.05 Scale Factor Error with Delta=300 4108
0.01 Scale Factor Error with Delta=300 102683
Priority Target DPS
SiphonStorm Priority Target Damage Per Second
Count 1017
Mean 3893.73
Minimum 3498.44
Maximum 4429.05
Spread ( max - min ) 930.61
Range [ ( max - min ) / 2 * 100% ] 11.95%
Standard Deviation 149.7849
5th Percentile 3664.56
95th Percentile 4156.00
( 95th Percentile - 5th Percentile ) 491.44
Mean Distribution
Standard Deviation 4.6969
95.00% Confidence Interval ( 3884.52 - 3902.93 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5685
0.1 Scale Factor Error with Delta=300 192
0.05 Scale Factor Error with Delta=300 767
0.01 Scale Factor Error with Delta=300 19153
DPS(e)
SiphonStorm Damage Per Second (Effective)
Count 1017
Mean 13743.86
Minimum 12902.11
Maximum 14840.81
Spread ( max - min ) 1938.70
Range [ ( max - min ) / 2 * 100% ] 7.05%
Damage
SiphonStorm Damage
Count 1017
Mean 4095973.83
Minimum 3175950.38
Maximum 4906308.38
Spread ( max - min ) 1730358.00
Range [ ( max - min ) / 2 * 100% ] 21.12%
DTPS
SiphonStorm Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
SiphonStorm Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
SiphonStorm Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
SiphonStorm Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
SiphonStorm Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
SiphonStorm Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
SiphonStormTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
SiphonStorm Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 0.97 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
k 2.43 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
l 0.77 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
m 0.51 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 5.25 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 0.41 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
q 13.51 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
r 157.94 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
s 58.14 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
t 0.63 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
u 0.02 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
v 0.03 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
w 0.07 arcane_barrage
actions.shared_cds
# count action,conditions
x 2.65 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
y 2.85 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

0145789ABGILMNPQRVXZnkyz{sqsrrrrsrrrrsrrrrpsrrrxrsqsrrrrsrrrrsrrrrsrrrrsqsrrrrsrrrrsrnpsqsrrrrsrrrrsrrrrsqsrrrrsrrrrsrrrrsnpsqsrrrrsrrrrmkysrrrrsqsrrrrsrrrxrsrrnpsqsrrrrsrrrrsrrrrsqsrrrrsrrrrsrrrrsnpsqsrrrrsrrrrsrrrrsqsrrrrsrrrrsrrrrsqsljky{srrrrsrrrrsqpsrrrrsrrrrsrrxrrsqsrrrrsrrrrsrrrr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 1 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat N am_spam Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Q flask SiphonStorm 65394.3/65394: 100% mana
Pre precombat R food SiphonStorm 65394.3/65394: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Z evocation SiphonStorm 65394.3/65394: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 65394.3/65394: 100% mana siphon_storm(6)
0:01.261 aoe k arcane_power Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, siphon_storm(6)
0:01.261 shared_cds y use_items Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_power, rune_of_power, siphon_storm(6)
0:01.261 shared_cds z potion Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_power, rune_of_power, siphon_storm(6), gladiators_badge
0:01.261 shared_cds { berserking Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_power, rune_of_power, siphon_storm(6), potion_of_deathly_fixation, gladiators_badge
0:01.261 aoe s arcane_barrage Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, berserking, arcane_power, rune_of_power, siphon_storm(6), potion_of_deathly_fixation, gladiators_badge
0:02.142 aoe q arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.024 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.909 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.791 aoe r arcane_explosion Fluffy_Pillow 64047.8/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.674 aoe r arcane_explosion Fluffy_Pillow 62702.7/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.560 aoe r arcane_explosion Fluffy_Pillow 61361.5/65394: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.446 aoe s arcane_barrage Fluffy_Pillow 60020.3/65394: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.328 aoe r arcane_explosion Fluffy_Pillow 63789.6/65394: 98% mana bloodlust, berserking, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.211 aoe r arcane_explosion Fluffy_Pillow 62444.5/65394: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.094 aoe r arcane_explosion Fluffy_Pillow 61099.3/65394: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.977 aoe r arcane_explosion Fluffy_Pillow 59754.2/65394: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:11.861 aoe s arcane_barrage Fluffy_Pillow 58410.4/65394: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.745 aoe r arcane_explosion Fluffy_Pillow 62182.3/65394: 95% mana bloodlust, berserking, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.630 aoe r arcane_explosion Fluffy_Pillow 60839.8/65394: 93% mana bloodlust, arcane_charge, arcane_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.601 aoe r arcane_explosion Fluffy_Pillow 59609.7/65394: 91% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.572 aoe r arcane_explosion Fluffy_Pillow 60879.7/65394: 93% mana bloodlust, arcane_charge(3), arcane_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.543 aoe p rune_of_power Fluffy_Pillow 59649.7/65394: 91% mana bloodlust, arcane_charge(4), siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:17.513 aoe s arcane_barrage Fluffy_Pillow 60918.3/65394: 93% mana bloodlust, arcane_charge(4), rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:18.484 aoe r arcane_explosion Fluffy_Pillow 64804.0/65394: 99% mana bloodlust, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:19.455 aoe r arcane_explosion Fluffy_Pillow 61074.0/65394: 93% mana bloodlust, arcane_charge, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:20.426 aoe r arcane_explosion Fluffy_Pillow 57343.9/65394: 88% mana bloodlust, arcane_charge(2), rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:21.399 shared_cds x use_mana_gem SiphonStorm 53616.5/65394: 82% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:21.399 aoe r arcane_explosion Fluffy_Pillow 60155.9/65394: 92% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, siphon_storm(6), crimson_chorus(2), potion_of_deathly_fixation
0:22.371 aoe s arcane_barrage Fluffy_Pillow 61427.2/65394: 94% mana bloodlust, arcane_charge(4), rune_of_power, siphon_storm(6), crimson_chorus(3), potion_of_deathly_fixation
0:23.342 aoe q arcane_orb Fluffy_Pillow 65312.9/65394: 100% mana bloodlust, rune_of_power, siphon_storm(6), crimson_chorus(3), potion_of_deathly_fixation
0:24.311 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, arcane_charge(4), rune_of_power, siphon_storm(6), crimson_chorus(3), potion_of_deathly_fixation
0:25.282 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, rune_of_power, siphon_storm(6), crimson_chorus(3), potion_of_deathly_fixation
0:26.252 aoe r arcane_explosion Fluffy_Pillow 61662.9/65394: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, siphon_storm(6), crimson_chorus(3), potion_of_deathly_fixation
0:27.224 aoe r arcane_explosion Fluffy_Pillow 62934.2/65394: 96% mana bloodlust, arcane_charge(2), rune_of_power, siphon_storm(6), crimson_chorus(3)
0:28.196 aoe r arcane_explosion Fluffy_Pillow 59205.5/65394: 91% mana bloodlust, arcane_charge(3), rune_of_power, siphon_storm(6), crimson_chorus(3)
0:29.166 aoe s arcane_barrage Fluffy_Pillow 55474.1/65394: 85% mana bloodlust, arcane_charge(4), rune_of_power, siphon_storm(6), crimson_chorus(3)
0:30.138 aoe r arcane_explosion Fluffy_Pillow 59361.2/65394: 91% mana bloodlust, crimson_chorus(3)
0:31.109 aoe r arcane_explosion Fluffy_Pillow 55631.1/65394: 85% mana bloodlust, arcane_charge, crimson_chorus(3)
0:32.080 aoe r arcane_explosion Fluffy_Pillow 51901.1/65394: 79% mana bloodlust, arcane_charge(2)
0:33.053 aoe r arcane_explosion Fluffy_Pillow 48173.6/65394: 74% mana bloodlust, arcane_charge(3)
0:34.022 aoe s arcane_barrage Fluffy_Pillow 44441.0/65394: 68% mana bloodlust, arcane_charge(4), clearcasting
0:34.993 aoe r arcane_explosion Fluffy_Pillow 48326.7/65394: 74% mana bloodlust, clearcasting
0:35.966 aoe r arcane_explosion Fluffy_Pillow 49599.3/65394: 76% mana bloodlust, arcane_charge
0:36.938 aoe r arcane_explosion Fluffy_Pillow 45870.5/65394: 70% mana bloodlust, arcane_charge(2)
0:37.910 aoe r arcane_explosion Fluffy_Pillow 42141.8/65394: 64% mana bloodlust, arcane_charge(3)
0:38.881 aoe s arcane_barrage Fluffy_Pillow 38411.8/65394: 59% mana bloodlust, arcane_charge(4)
0:39.853 aoe r arcane_explosion Fluffy_Pillow 42298.8/65394: 65% mana bloodlust
0:40.826 aoe r arcane_explosion Fluffy_Pillow 38571.4/65394: 59% mana bloodlust, arcane_charge, clearcasting
0:41.798 aoe r arcane_explosion Fluffy_Pillow 39842.6/65394: 61% mana arcane_charge(2)
0:43.058 aoe r arcane_explosion Fluffy_Pillow 36490.6/65394: 56% mana arcane_charge(3)
0:44.319 aoe s arcane_barrage Fluffy_Pillow 33139.8/65394: 51% mana arcane_charge(4), clearcasting
0:45.582 aoe q arcane_orb Fluffy_Pillow 37407.5/65394: 57% mana clearcasting
0:46.842 aoe s arcane_barrage Fluffy_Pillow 38555.4/65394: 59% mana arcane_charge(4), clearcasting
0:48.104 aoe r arcane_explosion Fluffy_Pillow 42821.7/65394: 65% mana clearcasting
0:49.365 aoe r arcane_explosion Fluffy_Pillow 44471.0/65394: 68% mana arcane_charge
0:50.626 aoe r arcane_explosion Fluffy_Pillow 41120.2/65394: 63% mana arcane_charge(2)
0:51.889 aoe r arcane_explosion Fluffy_Pillow 37772.1/65394: 58% mana arcane_charge(3)
0:53.149 aoe s arcane_barrage Fluffy_Pillow 34420.0/65394: 53% mana arcane_charge(4)
0:54.411 aoe r arcane_explosion Fluffy_Pillow 38686.3/65394: 59% mana
0:55.672 aoe r arcane_explosion Fluffy_Pillow 35335.6/65394: 54% mana arcane_charge
0:56.935 aoe r arcane_explosion Fluffy_Pillow 31987.4/65394: 49% mana arcane_charge(2)
0:58.196 aoe r arcane_explosion Fluffy_Pillow 28636.7/65394: 44% mana arcane_charge(3)
0:59.459 aoe s arcane_barrage Fluffy_Pillow 25288.5/65394: 39% mana arcane_charge(4)
1:00.720 aoe r arcane_explosion Fluffy_Pillow 29553.5/65394: 45% mana
1:01.982 aoe n touch_of_the_magi Fluffy_Pillow 26204.1/65394: 40% mana arcane_charge, clearcasting
1:03.242 aoe p rune_of_power Fluffy_Pillow 25352.0/65394: 39% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.504 aoe s arcane_barrage Fluffy_Pillow 27002.6/65394: 41% mana arcane_charge(4), clearcasting(2), rune_of_power, crimson_chorus
1:05.766 aoe q arcane_orb Fluffy_Pillow 31268.9/65394: 48% mana clearcasting(2), rune_of_power, crimson_chorus
1:07.026 aoe s arcane_barrage Fluffy_Pillow 32416.8/65394: 50% mana arcane_charge(4), clearcasting(2), rune_of_power, crimson_chorus
1:08.287 aoe r arcane_explosion Fluffy_Pillow 36681.9/65394: 56% mana clearcasting(2), rune_of_power, crimson_chorus
1:09.548 aoe r arcane_explosion Fluffy_Pillow 38331.1/65394: 59% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus
1:10.811 aoe r arcane_explosion Fluffy_Pillow 39983.0/65394: 61% mana arcane_charge(2), rune_of_power, crimson_chorus
1:12.072 aoe r arcane_explosion Fluffy_Pillow 36632.2/65394: 56% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus
1:13.333 aoe s arcane_barrage Fluffy_Pillow 38281.4/65394: 59% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.595 aoe r arcane_explosion Fluffy_Pillow 42547.8/65394: 65% mana rune_of_power, crimson_chorus(2)
1:15.857 aoe r arcane_explosion Fluffy_Pillow 39198.3/65394: 60% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.118 aoe r arcane_explosion Fluffy_Pillow 35847.6/65394: 55% mana arcane_charge(2), crimson_chorus(2)
1:18.378 aoe r arcane_explosion Fluffy_Pillow 32495.5/65394: 50% mana arcane_charge(3), crimson_chorus(2)
1:19.640 aoe s arcane_barrage Fluffy_Pillow 29146.1/65394: 45% mana arcane_charge(4), crimson_chorus(2)
1:20.901 aoe r arcane_explosion Fluffy_Pillow 33411.1/65394: 51% mana crimson_chorus(2)
1:22.164 aoe r arcane_explosion Fluffy_Pillow 30062.9/65394: 46% mana arcane_charge, clearcasting, crimson_chorus(2)
1:23.427 aoe r arcane_explosion Fluffy_Pillow 31714.8/65394: 48% mana arcane_charge(2), crimson_chorus(3)
1:24.686 aoe r arcane_explosion Fluffy_Pillow 28361.4/65394: 43% mana arcane_charge(3), crimson_chorus(3)
1:25.947 aoe s arcane_barrage Fluffy_Pillow 25010.7/65394: 38% mana arcane_charge(4), clearcasting, crimson_chorus(3)
1:27.209 aoe q arcane_orb Fluffy_Pillow 29277.0/65394: 45% mana clearcasting, crimson_chorus(3)
1:28.469 aoe s arcane_barrage Fluffy_Pillow 30424.9/65394: 47% mana arcane_charge(4), clearcasting, crimson_chorus(3)
1:29.730 aoe r arcane_explosion Fluffy_Pillow 34689.9/65394: 53% mana clearcasting, crimson_chorus(3)
1:30.993 aoe r arcane_explosion Fluffy_Pillow 36341.8/65394: 56% mana arcane_charge, crimson_chorus(3)
1:32.255 aoe r arcane_explosion Fluffy_Pillow 32992.3/65394: 50% mana arcane_charge(2), crimson_chorus(3)
1:33.515 aoe r arcane_explosion Fluffy_Pillow 29640.3/65394: 45% mana arcane_charge(3)
1:34.777 aoe s arcane_barrage Fluffy_Pillow 26290.8/65394: 40% mana arcane_charge(4), clearcasting
1:36.037 aoe r arcane_explosion Fluffy_Pillow 30554.5/65394: 47% mana clearcasting
1:37.298 aoe r arcane_explosion Fluffy_Pillow 32203.8/65394: 49% mana arcane_charge
1:38.560 aoe r arcane_explosion Fluffy_Pillow 28854.3/65394: 44% mana arcane_charge(2)
1:39.821 aoe r arcane_explosion Fluffy_Pillow 25503.6/65394: 39% mana arcane_charge(3)
1:41.083 aoe s arcane_barrage Fluffy_Pillow 22154.1/65394: 34% mana arcane_charge(4)
1:42.344 aoe r arcane_explosion Fluffy_Pillow 26419.1/65394: 40% mana
1:43.605 aoe r arcane_explosion Fluffy_Pillow 23068.4/65394: 35% mana arcane_charge, clearcasting
1:44.866 aoe r arcane_explosion Fluffy_Pillow 24717.6/65394: 38% mana arcane_charge(2)
1:46.128 aoe r arcane_explosion Fluffy_Pillow 21368.2/65394: 33% mana arcane_charge(3)
1:47.389 aoe s arcane_barrage Fluffy_Pillow 18017.4/65394: 28% mana arcane_charge(4)
1:48.651 aoe n touch_of_the_magi Fluffy_Pillow 22283.8/65394: 34% mana
1:49.912 aoe p rune_of_power Fluffy_Pillow 21433.0/65394: 33% mana arcane_charge(4)
1:51.175 aoe s arcane_barrage Fluffy_Pillow 23084.9/65394: 35% mana arcane_charge(4), rune_of_power
1:52.437 aoe q arcane_orb Fluffy_Pillow 27351.2/65394: 42% mana rune_of_power
1:53.698 aoe s arcane_barrage Fluffy_Pillow 28500.4/65394: 44% mana arcane_charge(4), rune_of_power
1:54.960 aoe r arcane_explosion Fluffy_Pillow 32766.7/65394: 50% mana rune_of_power
1:56.220 aoe r arcane_explosion Fluffy_Pillow 29414.7/65394: 45% mana arcane_charge, rune_of_power
1:57.482 aoe r arcane_explosion Fluffy_Pillow 26065.2/65394: 40% mana arcane_charge(2), rune_of_power
1:58.743 aoe r arcane_explosion Fluffy_Pillow 22714.5/65394: 35% mana arcane_charge(3), clearcasting, rune_of_power
2:00.004 aoe s arcane_barrage Fluffy_Pillow 24363.7/65394: 37% mana arcane_charge(4), rune_of_power
2:01.266 aoe r arcane_explosion Fluffy_Pillow 28630.0/65394: 44% mana rune_of_power
2:02.528 aoe r arcane_explosion Fluffy_Pillow 25280.6/65394: 39% mana arcane_charge, rune_of_power
2:03.792 aoe r arcane_explosion Fluffy_Pillow 21933.8/65394: 34% mana arcane_charge(2), clearcasting
2:05.053 aoe r arcane_explosion Fluffy_Pillow 23583.0/65394: 36% mana arcane_charge(3), crimson_chorus
2:06.314 aoe m evocation SiphonStorm 20232.3/65394: 31% mana arcane_charge(4), crimson_chorus
2:10.510 aoe k arcane_power Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), siphon_storm(6), crimson_chorus
2:10.510 shared_cds y use_items Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus
2:10.510 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, gladiators_badge
2:11.772 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, gladiators_badge
2:13.031 aoe r arcane_explosion Fluffy_Pillow 64540.9/65394: 99% mana arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus, gladiators_badge
2:14.294 aoe r arcane_explosion Fluffy_Pillow 63692.8/65394: 97% mana arcane_charge(2), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:15.555 aoe r arcane_explosion Fluffy_Pillow 62842.0/65394: 96% mana arcane_charge(3), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:16.818 aoe s arcane_barrage Fluffy_Pillow 61993.9/65394: 95% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:18.080 aoe q arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:19.340 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:20.601 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:21.862 aoe r arcane_explosion Fluffy_Pillow 64543.5/65394: 99% mana arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:23.125 aoe r arcane_explosion Fluffy_Pillow 63695.4/65394: 97% mana arcane_charge(2), arcane_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
2:24.386 aoe r arcane_explosion Fluffy_Pillow 62844.6/65394: 96% mana arcane_charge(3), arcane_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
2:25.650 aoe s arcane_barrage Fluffy_Pillow 61997.8/65394: 95% mana arcane_charge(4), siphon_storm(6), crimson_chorus(3)
2:26.911 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana siphon_storm(6), crimson_chorus(3)
2:28.172 aoe r arcane_explosion Fluffy_Pillow 62043.5/65394: 95% mana arcane_charge, siphon_storm(6), crimson_chorus(3)
2:29.432 aoe r arcane_explosion Fluffy_Pillow 58691.5/65394: 90% mana arcane_charge(2), siphon_storm(6), crimson_chorus(3)
2:30.694 shared_cds x use_mana_gem SiphonStorm 55342.0/65394: 85% mana arcane_charge(3), siphon_storm(6), crimson_chorus(3)
2:30.694 aoe r arcane_explosion Fluffy_Pillow 61881.4/65394: 95% mana arcane_charge(3), siphon_storm(6), crimson_chorus(3)
2:31.955 aoe s arcane_barrage Fluffy_Pillow 58530.7/65394: 90% mana arcane_charge(4), siphon_storm(6), crimson_chorus(3)
2:33.217 aoe r arcane_explosion Fluffy_Pillow 62797.0/65394: 96% mana siphon_storm(6), crimson_chorus(3)
2:34.480 aoe r arcane_explosion Fluffy_Pillow 59448.9/65394: 91% mana arcane_charge, siphon_storm(6)
2:35.743 aoe n touch_of_the_magi Fluffy_Pillow 56100.7/65394: 86% mana arcane_charge(2), clearcasting, siphon_storm(6)
2:37.005 aoe p rune_of_power Fluffy_Pillow 55251.3/65394: 84% mana arcane_charge(4), clearcasting, siphon_storm(6)
2:38.269 aoe s arcane_barrage Fluffy_Pillow 56904.5/65394: 87% mana arcane_charge(4), clearcasting, rune_of_power, siphon_storm(6)
2:39.529 aoe q arcane_orb Fluffy_Pillow 61168.2/65394: 94% mana clearcasting, rune_of_power, siphon_storm(6)
2:40.789 aoe s arcane_barrage Fluffy_Pillow 62316.1/65394: 95% mana arcane_charge(4), clearcasting, rune_of_power
2:42.051 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana clearcasting, rune_of_power
2:43.313 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge, rune_of_power
2:44.575 aoe r arcane_explosion Fluffy_Pillow 62044.8/65394: 95% mana arcane_charge(2), rune_of_power
2:45.837 aoe r arcane_explosion Fluffy_Pillow 58695.4/65394: 90% mana arcane_charge(3), clearcasting, rune_of_power
2:47.098 aoe s arcane_barrage Fluffy_Pillow 60344.6/65394: 92% mana arcane_charge(4), rune_of_power
2:48.361 aoe r arcane_explosion Fluffy_Pillow 64612.3/65394: 99% mana rune_of_power
2:49.623 aoe r arcane_explosion Fluffy_Pillow 61262.8/65394: 94% mana arcane_charge, rune_of_power
2:50.885 aoe r arcane_explosion Fluffy_Pillow 57913.4/65394: 89% mana arcane_charge(2), clearcasting
2:52.145 aoe r arcane_explosion Fluffy_Pillow 59561.3/65394: 91% mana arcane_charge(3)
2:53.407 aoe s arcane_barrage Fluffy_Pillow 56211.9/65394: 86% mana arcane_charge(4)
2:54.669 aoe r arcane_explosion Fluffy_Pillow 60478.2/65394: 92% mana
2:55.930 aoe r arcane_explosion Fluffy_Pillow 57127.4/65394: 87% mana arcane_charge
2:57.191 aoe r arcane_explosion Fluffy_Pillow 53776.7/65394: 82% mana arcane_charge(2)
2:58.454 aoe r arcane_explosion Fluffy_Pillow 50428.5/65394: 77% mana arcane_charge(3)
2:59.716 aoe s arcane_barrage Fluffy_Pillow 47079.1/65394: 72% mana arcane_charge(4)
3:00.977 aoe q arcane_orb Fluffy_Pillow 51344.1/65394: 79% mana
3:02.239 aoe s arcane_barrage Fluffy_Pillow 52494.6/65394: 80% mana arcane_charge(4)
3:03.500 aoe r arcane_explosion Fluffy_Pillow 56759.7/65394: 87% mana
3:04.761 aoe r arcane_explosion Fluffy_Pillow 53408.9/65394: 82% mana arcane_charge, clearcasting
3:06.023 aoe r arcane_explosion Fluffy_Pillow 55059.5/65394: 84% mana arcane_charge(2), crimson_chorus
3:07.283 aoe r arcane_explosion Fluffy_Pillow 51707.4/65394: 79% mana arcane_charge(3), crimson_chorus
3:08.545 aoe s arcane_barrage Fluffy_Pillow 48357.9/65394: 74% mana arcane_charge(4), clearcasting, crimson_chorus
3:09.808 aoe r arcane_explosion Fluffy_Pillow 52625.6/65394: 80% mana clearcasting, crimson_chorus
3:11.070 aoe r arcane_explosion Fluffy_Pillow 54276.1/65394: 83% mana arcane_charge, crimson_chorus
3:12.331 aoe r arcane_explosion Fluffy_Pillow 50925.4/65394: 78% mana arcane_charge(2), crimson_chorus
3:13.592 aoe r arcane_explosion Fluffy_Pillow 47574.6/65394: 73% mana arcane_charge(3), crimson_chorus
3:14.853 aoe s arcane_barrage Fluffy_Pillow 44223.9/65394: 68% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:16.114 aoe r arcane_explosion Fluffy_Pillow 48488.9/65394: 74% mana clearcasting, crimson_chorus(2)
3:17.375 aoe r arcane_explosion Fluffy_Pillow 50138.1/65394: 77% mana arcane_charge, crimson_chorus(2)
3:18.639 aoe r arcane_explosion Fluffy_Pillow 46791.3/65394: 72% mana arcane_charge(2), crimson_chorus(2)
3:19.900 aoe r arcane_explosion Fluffy_Pillow 43440.5/65394: 66% mana arcane_charge(3), crimson_chorus(2)
3:21.162 aoe s arcane_barrage Fluffy_Pillow 40091.1/65394: 61% mana arcane_charge(4), crimson_chorus(2)
3:22.425 aoe n touch_of_the_magi Fluffy_Pillow 44358.7/65394: 68% mana crimson_chorus(2)
3:23.686 aoe p rune_of_power Fluffy_Pillow 43508.0/65394: 67% mana arcane_charge(4), crimson_chorus(2)
3:24.947 aoe s arcane_barrage Fluffy_Pillow 45157.2/65394: 69% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:26.209 aoe q arcane_orb Fluffy_Pillow 49423.5/65394: 76% mana rune_of_power, crimson_chorus(3)
3:27.470 aoe s arcane_barrage Fluffy_Pillow 50572.8/65394: 77% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:28.733 aoe r arcane_explosion Fluffy_Pillow 54840.4/65394: 84% mana rune_of_power, crimson_chorus(3)
3:29.995 aoe r arcane_explosion Fluffy_Pillow 51490.9/65394: 79% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:31.256 aoe r arcane_explosion Fluffy_Pillow 48140.2/65394: 74% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(3)
3:32.519 aoe r arcane_explosion Fluffy_Pillow 49792.1/65394: 76% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
3:33.779 aoe s arcane_barrage Fluffy_Pillow 46440.0/65394: 71% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3)
3:35.041 aoe r arcane_explosion Fluffy_Pillow 50706.3/65394: 78% mana clearcasting, rune_of_power
3:36.302 aoe r arcane_explosion Fluffy_Pillow 52355.6/65394: 80% mana arcane_charge, rune_of_power
3:37.564 aoe r arcane_explosion Fluffy_Pillow 49006.1/65394: 75% mana arcane_charge(2)
3:38.826 aoe r arcane_explosion Fluffy_Pillow 45656.7/65394: 70% mana arcane_charge(3), clearcasting
3:40.088 aoe s arcane_barrage Fluffy_Pillow 47307.2/65394: 72% mana arcane_charge(4)
3:41.350 aoe r arcane_explosion Fluffy_Pillow 51573.5/65394: 79% mana
3:42.612 aoe r arcane_explosion Fluffy_Pillow 48224.1/65394: 74% mana arcane_charge
3:43.874 aoe r arcane_explosion Fluffy_Pillow 44874.6/65394: 69% mana arcane_charge(2)
3:45.138 aoe r arcane_explosion Fluffy_Pillow 41527.8/65394: 64% mana arcane_charge(3), clearcasting
3:46.401 aoe s arcane_barrage Fluffy_Pillow 43179.7/65394: 66% mana arcane_charge(4)
3:47.663 aoe q arcane_orb Fluffy_Pillow 47446.0/65394: 73% mana
3:48.924 aoe s arcane_barrage Fluffy_Pillow 48595.2/65394: 74% mana arcane_charge(4)
3:50.187 aoe r arcane_explosion Fluffy_Pillow 52862.9/65394: 81% mana
3:51.450 aoe r arcane_explosion Fluffy_Pillow 49514.7/65394: 76% mana arcane_charge
3:52.712 aoe r arcane_explosion Fluffy_Pillow 46165.3/65394: 71% mana arcane_charge(2)
3:53.972 aoe r arcane_explosion Fluffy_Pillow 42813.2/65394: 65% mana arcane_charge(3)
3:55.234 aoe s arcane_barrage Fluffy_Pillow 39463.8/65394: 60% mana arcane_charge(4)
3:56.495 aoe r arcane_explosion Fluffy_Pillow 43728.8/65394: 67% mana
3:57.757 aoe r arcane_explosion Fluffy_Pillow 40379.3/65394: 62% mana arcane_charge, clearcasting
3:59.019 aoe r arcane_explosion Fluffy_Pillow 42029.9/65394: 64% mana arcane_charge(2)
4:00.281 aoe r arcane_explosion Fluffy_Pillow 38680.4/65394: 59% mana arcane_charge(3)
4:01.543 aoe s arcane_barrage Fluffy_Pillow 35331.0/65394: 54% mana arcane_charge(4), clearcasting
4:02.805 aoe r arcane_explosion Fluffy_Pillow 39597.3/65394: 61% mana clearcasting
4:04.066 aoe r arcane_explosion Fluffy_Pillow 41246.6/65394: 63% mana arcane_charge
4:05.326 aoe r arcane_explosion Fluffy_Pillow 37894.5/65394: 58% mana arcane_charge(2)
4:06.587 aoe r arcane_explosion Fluffy_Pillow 34543.7/65394: 53% mana arcane_charge(3), clearcasting, crimson_chorus
4:07.849 aoe s arcane_barrage Fluffy_Pillow 36194.3/65394: 55% mana arcane_charge(4), crimson_chorus
4:09.111 aoe q arcane_orb Fluffy_Pillow 40460.6/65394: 62% mana crimson_chorus
4:10.373 aoe s arcane_barrage Fluffy_Pillow 41611.2/65394: 64% mana arcane_charge(4), crimson_chorus
4:11.635 aoe l evocation SiphonStorm 45877.5/65394: 70% mana crimson_chorus
4:16.888 aoe j touch_of_the_magi Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge, siphon_storm(6), crimson_chorus(2)
4:18.150 aoe k arcane_power Fluffy_Pillow 62900.8/65394: 96% mana arcane_charge(4), siphon_storm(6), crimson_chorus(2)
4:18.150 shared_cds y use_items Fluffy_Pillow 62900.8/65394: 96% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2)
4:18.150 shared_cds { berserking Fluffy_Pillow 62900.8/65394: 96% mana arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:18.150 aoe s arcane_barrage Fluffy_Pillow 62900.8/65394: 96% mana berserking, arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:19.297 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana berserking, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:20.445 aoe r arcane_explosion Fluffy_Pillow 64395.7/65394: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:21.594 aoe r arcane_explosion Fluffy_Pillow 63398.5/65394: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:22.742 aoe r arcane_explosion Fluffy_Pillow 62400.0/65394: 95% mana berserking, arcane_charge(3), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:23.890 aoe s arcane_barrage Fluffy_Pillow 61401.4/65394: 94% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:25.038 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana berserking, arcane_power, clearcasting, rune_of_power, siphon_storm(6), crimson_chorus(2), gladiators_badge
4:26.185 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana berserking, arcane_charge, arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:27.334 aoe r arcane_explosion Fluffy_Pillow 64397.0/65394: 98% mana berserking, arcane_charge(2), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:28.481 aoe r arcane_explosion Fluffy_Pillow 63397.2/65394: 97% mana berserking, arcane_charge(3), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:29.628 aoe s arcane_barrage Fluffy_Pillow 62397.3/65394: 95% mana berserking, arcane_charge(4), arcane_power, rune_of_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:30.773 aoe q arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana arcane_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:32.034 aoe p rune_of_power Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), arcane_power, siphon_storm(6), crimson_chorus(3), gladiators_badge
4:33.295 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), rune_of_power, siphon_storm(6), crimson_chorus(3)
4:34.557 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power, siphon_storm(6), crimson_chorus(3)
4:35.819 aoe r arcane_explosion Fluffy_Pillow 62044.8/65394: 95% mana arcane_charge, rune_of_power, siphon_storm(6)
4:37.082 aoe r arcane_explosion Fluffy_Pillow 58696.7/65394: 90% mana arcane_charge(2), clearcasting, rune_of_power, siphon_storm(6)
4:38.345 aoe r arcane_explosion Fluffy_Pillow 60348.6/65394: 92% mana arcane_charge(3), rune_of_power, siphon_storm(6)
4:39.608 aoe s arcane_barrage Fluffy_Pillow 57000.4/65394: 87% mana arcane_charge(4), clearcasting, rune_of_power, siphon_storm(6)
4:40.869 aoe r arcane_explosion Fluffy_Pillow 61265.4/65394: 94% mana clearcasting, rune_of_power, siphon_storm(6)
4:42.130 aoe r arcane_explosion Fluffy_Pillow 62914.7/65394: 96% mana arcane_charge, rune_of_power, siphon_storm(6)
4:43.392 aoe r arcane_explosion Fluffy_Pillow 59565.2/65394: 91% mana arcane_charge(2), rune_of_power, siphon_storm(6)
4:44.656 aoe r arcane_explosion Fluffy_Pillow 56218.4/65394: 86% mana arcane_charge(3), clearcasting, rune_of_power, siphon_storm(6)
4:45.918 aoe s arcane_barrage Fluffy_Pillow 57868.9/65394: 88% mana arcane_charge(4), siphon_storm(6)
4:47.180 aoe r arcane_explosion Fluffy_Pillow 62135.3/65394: 95% mana
4:48.441 aoe r arcane_explosion Fluffy_Pillow 58784.5/65394: 90% mana arcane_charge
4:49.704 shared_cds x use_mana_gem SiphonStorm 55436.4/65394: 85% mana arcane_charge(2), clearcasting
4:49.704 aoe r arcane_explosion Fluffy_Pillow 61975.8/65394: 95% mana arcane_charge(2), clearcasting
4:50.965 aoe r arcane_explosion Fluffy_Pillow 63625.0/65394: 97% mana arcane_charge(3)
4:52.227 aoe s arcane_barrage Fluffy_Pillow 60275.6/65394: 92% mana arcane_charge(4), clearcasting
4:53.488 aoe q arcane_orb Fluffy_Pillow 64540.6/65394: 99% mana clearcasting
4:54.751 aoe s arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge(4), clearcasting
4:56.012 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana clearcasting
4:57.272 aoe r arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge
4:58.534 aoe r arcane_explosion Fluffy_Pillow 62044.8/65394: 95% mana arcane_charge(2)
4:59.796 aoe r arcane_explosion Fluffy_Pillow 58695.4/65394: 90% mana arcane_charge(3)
5:01.058 aoe s arcane_barrage Fluffy_Pillow 55345.9/65394: 85% mana arcane_charge(4)
5:02.320 aoe r arcane_explosion Fluffy_Pillow 59612.3/65394: 91% mana
5:03.580 aoe r arcane_explosion Fluffy_Pillow 56260.2/65394: 86% mana arcane_charge
5:04.841 aoe r arcane_explosion Fluffy_Pillow 52909.4/65394: 81% mana arcane_charge(2)
5:06.102 aoe r arcane_explosion Fluffy_Pillow 49558.7/65394: 76% mana arcane_charge(3), clearcasting
5:07.363 aoe s arcane_barrage Fluffy_Pillow 51207.9/65394: 78% mana arcane_charge(4), crimson_chorus
5:08.625 aoe r arcane_explosion Fluffy_Pillow 55474.3/65394: 85% mana crimson_chorus
5:09.889 aoe r arcane_explosion Fluffy_Pillow 52127.4/65394: 80% mana arcane_charge, crimson_chorus
5:11.151 aoe r arcane_explosion Fluffy_Pillow 48778.0/65394: 75% mana arcane_charge(2), crimson_chorus
5:12.411 aoe r arcane_explosion Fluffy_Pillow 45425.9/65394: 69% mana arcane_charge(3), crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 65394 65394 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 19.24% 19.24% 635
Versatility 7.97% 7.97% 319
Mana Regen 1308 1308 0
Mastery 30.79% 30.79% 618
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Siphon Storm }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="SiphonStorm"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6649/6650/6758/6928/1532,ilevel=235,enchant_id=6168
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=635
# gear_mastery_rating=618
# gear_versatility_rating=319
# gear_armor=369

arcane : 13811 dps, 3887 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13811.3 13811.3 19.6 / 0.142% 1214.6 / 8.8% 6.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2218.1 2111.0 Mana 0.00% 53.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 13811
Arcane Barrage 5595 40.5% 60.1 4.98sec 27777 23662 Direct 300.2 4661 9518 5562 18.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.10 300.21 0.00 0.00 1.1739 0.0000 1669448.57 1669448.57 0.00% 23661.66 23661.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.45% 244.53 183 304 4660.85 2601 17560 4663.19 4266 5090 1139412 1139412 0.00%
crit 18.55% 55.69 32 85 9517.97 5201 35119 9524.03 6856 12385 530036 530036 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:60.10
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 6374 46.2% 165.9 1.78sec 11468 9884 Direct 829.7 1921 3924 2294 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 165.94 829.71 0.00 0.00 1.1602 0.0000 1903030.24 1903030.24 0.00% 9884.38 9884.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 675.09 519 837 1920.73 1427 3855 1921.71 1826 2040 1296487 1296487 0.00%
crit 18.64% 154.62 99 216 3923.51 2855 7710 3924.65 3514 4422 606543 606543 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:165.94
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1079) 0.0% (7.8%) 13.2 23.36sec 24343 20322

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.23 0.00 0.00 0.00 1.1979 0.0000 0.00 0.00 0.00% 20321.92 20321.92

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.23
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1079 7.8% 66.0 23.36sec 4878 0 Direct 66.0 4087 8405 4881 18.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.02 66.02 0.00 0.00 0.0000 0.0000 322061.72 322061.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.63% 53.89 35 72 4086.97 2821 7619 4085.89 3495 4601 220141 220141 0.00%
crit 18.37% 12.13 2 24 8404.92 5642 15237 8406.66 5892 11918 101920 101920 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (87) 0.0% (0.6%) 18.5 1.35sec 1375 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 87 0.6% 18.5 1.35sec 1375 0 Direct 18.5 1138 2277 1375 20.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.53 18.53 0.00 0.00 0.0000 0.0000 25486.84 25486.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.15% 14.67 7 23 1137.86 1117 1184 1137.83 1117 1184 16688 16688 0.00%
crit 20.85% 3.86 0 10 2276.88 2233 2367 2236.40 0 2367 8799 8799 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.3% 21.1 13.76sec 552 0 Direct 21.1 465 929 552 18.8%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.13 21.13 0.00 0.00 0.0000 0.0000 11656.26 11656.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.25% 17.17 4 33 464.51 453 481 464.51 453 475 7976 7976 0.00%
crit 18.75% 3.96 0 13 928.78 907 961 912.06 0 961 3680 3680 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1176 14.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1174.68 1174.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.25% 0.85 0 1 1023.69 1024 1024 872.71 0 1024 873 873 0.00%
crit 14.75% 0.15 0 1 2047.39 2047 2047 301.97 0 2047 302 302 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.1%) 1.0 0.00sec 5704 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 143  / 19 0.1% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5704.02 5704.02 0.00% 48.31 48.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.03% 93.63 78 104 40.52 30 51 40.51 39 42 3793 3793 0.00%
crit 19.97% 23.37 13 39 81.74 59 101 81.75 68 92 1911 1911 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (615) 0.0% (4.5%) 6.2 51.62sec 29540 23042

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 0.00 0.00 0.00 1.2821 0.0000 0.00 0.00 0.00% 23042.01 23042.01

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 615 4.5% 6.2 51.54sec 29540 0 Direct 31.0 5928 0 5928 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 31.00 0.00 0.00 0.0000 0.0000 183598.77 183598.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.00 25 35 5928.20 1017 35738 5917.00 3996 8385 183599 183599 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15503.32
  • base_dd_max:15503.32
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 126.93sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 253.75sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 210.55sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 7.13 0.00 4.1264 0.6934 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.20
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.41sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 1.1951 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.09
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.12sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [t]:1.46
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 125.09sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 60.9 190.5 4.9sec 1.2sec 3.6sec 74.11% 0.00% 27.4 (27.7) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 12.1s
  • trigger_min/max:0.0s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.05%
  • arcane_charge_2:16.68%
  • arcane_charge_3:16.92%
  • arcane_charge_4:21.46%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.9sec 126.9sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.1s / 131.9s
  • trigger_min/max:121.1s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:14.04%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.0sec 254.0sec 11.7sec 7.22% 7.14% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.3s / 258.8s
  • trigger_min/max:250.3s / 258.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.22%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.2 0.1 11.1sec 11.0sec 1.8sec 16.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.91%
  • clearcasting_2:0.15%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.7sec 51.85% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.4s
  • trigger_min/max:60.0s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.87%
  • crimson_chorus_2:17.29%
  • crimson_chorus_3:16.70%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 221.5sec 221.5sec 4.1sec 1.65% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:95.1s / 299.3s
  • trigger_min/max:95.1s / 299.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.65%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 126.9sec 126.9sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.1s / 131.9s
  • trigger_min/max:121.1s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.04%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.25% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 53.6s
  • trigger_min/max:13.0s / 53.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.25%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Temporal Warp 1.5 0.0 300.1sec 300.1sec 35.8sec 17.29% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 300.9s
  • trigger_min/max:300.0s / 300.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.29%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.51% 0.35% 5.02% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation110.7865.118326.029209.251113.765326.029
Rune of Power5.7020.10920.51235.91819.68148.418
Touch of the Magi4.4790.00021.41828.91017.85246.888
Arcane Power4.9701.09511.90614.5093.08423.350
Arcane Barrage2.6270.0008.258158.950125.903194.032
Arcane Orb3.2350.00010.32543.02731.02364.238
Time Warp0.9070.0001.3031.3271.2972.245

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 480.06 394175.15 62.53% 821.10 7637.19 1.90%
Evocation Mana 55.23 61124.29 9.70% 1106.77 0.00 0.00%
Mana Gem Mana 2.76 18579.37 2.95% 6736.57 0.00 0.00%
Arcane Barrage Mana 60.10 156492.74 24.83% 2603.80 5458.87 3.37%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2110.96 2218.14 13102.3 35350.8 179.0 67365.7
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 165.9 636996.6 3838.8 3838.7 3.0
arcane_orb Mana 13.2 5918.9 447.3 447.4 54.4
time_warp Mana 1.5 2925.5 2000.0 1990.1 0.0
touch_of_the_magi Mana 6.2 15530.0 2500.0 2498.7 11.8

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
arcane Damage Per Second
Count 1017
Mean 13811.26
Minimum 12942.50
Maximum 14880.14
Spread ( max - min ) 1937.64
Range [ ( max - min ) / 2 * 100% ] 7.01%
Standard Deviation 318.7955
5th Percentile 13318.34
95th Percentile 14371.70
( 95th Percentile - 5th Percentile ) 1053.36
Mean Distribution
Standard Deviation 9.9966
95.00% Confidence Interval ( 13791.66 - 13830.85 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2047
0.1 Scale Factor Error with Delta=300 868
0.05 Scale Factor Error with Delta=300 3471
0.01 Scale Factor Error with Delta=300 86758
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1017
Mean 3886.76
Minimum 3458.11
Maximum 4457.76
Spread ( max - min ) 999.65
Range [ ( max - min ) / 2 * 100% ] 12.86%
Standard Deviation 143.1096
5th Percentile 3667.66
95th Percentile 4130.89
( 95th Percentile - 5th Percentile ) 463.23
Mean Distribution
Standard Deviation 4.4875
95.00% Confidence Interval ( 3877.97 - 3895.56 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5208
0.1 Scale Factor Error with Delta=300 175
0.05 Scale Factor Error with Delta=300 700
0.01 Scale Factor Error with Delta=300 17484
DPS(e)
arcane Damage Per Second (Effective)
Count 1017
Mean 13811.26
Minimum 12942.50
Maximum 14880.14
Spread ( max - min ) 1937.64
Range [ ( max - min ) / 2 * 100% ] 7.01%
Damage
arcane Damage
Count 1017
Mean 4116457.08
Minimum 3212356.35
Maximum 4968893.53
Spread ( max - min ) 1756537.17
Range [ ( max - min ) / 2 * 100% ] 21.34%
DTPS
arcane Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.09 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.23 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 165.94 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 60.10 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.20 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
r 2.86 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
t 1.46 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjtkrsuomonnnnonnnnonnnnlonnnnonnqnnomonnnnonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnkronnnnonnnnqomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnpnomonnnnonnnnonjkruonnnnoqmonnnnlonnnnonnnnomonnnnonnnnontnnnomonnnnon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask arcane 67365.7/67366: 100% mana
Pre precombat R food arcane 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana
0:01.299 shared_cds t time_warp Fluffy_Pillow 64871.1/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.299 aoe k arcane_power Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.299 shared_cds r use_items Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.299 shared_cds s potion Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.299 shared_cds u berserking Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.299 aoe o arcane_barrage Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.054 aoe m arcane_orb Fluffy_Pillow 66583.0/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.809 aoe o arcane_barrage Fluffy_Pillow 67350.2/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.563 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.319 aoe n arcane_explosion Fluffy_Pillow 65884.3/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.073 aoe n arcane_explosion Fluffy_Pillow 64400.2/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.827 aoe n arcane_explosion Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.582 aoe o arcane_barrage Fluffy_Pillow 63933.3/67366: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.336 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.089 aoe n arcane_explosion Fluffy_Pillow 65880.2/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.843 aoe n arcane_explosion Fluffy_Pillow 64396.1/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.597 aoe n arcane_explosion Fluffy_Pillow 62912.0/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.351 aoe o arcane_barrage Fluffy_Pillow 61427.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.105 aoe n arcane_explosion Fluffy_Pillow 65138.4/67366: 97% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.859 aoe n arcane_explosion Fluffy_Pillow 66154.2/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.613 aoe n arcane_explosion Fluffy_Pillow 64670.1/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.368 aoe n arcane_explosion Fluffy_Pillow 63187.3/67366: 94% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.137 aoe l rune_of_power Fluffy_Pillow 64223.4/67366: 95% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.908 aoe o arcane_barrage Fluffy_Pillow 65262.2/67366: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.678 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.449 aoe n arcane_explosion Fluffy_Pillow 65904.5/67366: 98% mana bloodlust, arcane_charge, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.220 aoe n arcane_explosion Fluffy_Pillow 66943.3/67366: 99% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.991 aoe n arcane_explosion Fluffy_Pillow 62982.1/67366: 93% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.760 aoe o arcane_barrage Fluffy_Pillow 59018.1/67366: 88% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.528 aoe n arcane_explosion Fluffy_Pillow 62747.5/67366: 93% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.299 aoe n arcane_explosion Fluffy_Pillow 58786.3/67366: 87% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.069 shared_cds q use_mana_gem arcane 54823.7/67366: 81% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.069 aoe n arcane_explosion Fluffy_Pillow 61560.3/67366: 91% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.841 aoe n arcane_explosion Fluffy_Pillow 57600.4/67366: 86% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.611 aoe o arcane_barrage Fluffy_Pillow 53637.8/67366: 80% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.381 aoe m arcane_orb Fluffy_Pillow 57369.9/67366: 85% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.151 aoe o arcane_barrage Fluffy_Pillow 57907.3/67366: 86% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.921 aoe n arcane_explosion Fluffy_Pillow 61639.4/67366: 91% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.693 aoe n arcane_explosion Fluffy_Pillow 57679.5/67366: 86% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.463 aoe n arcane_explosion Fluffy_Pillow 53717.0/67366: 80% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.233 aoe n arcane_explosion Fluffy_Pillow 49754.4/67366: 74% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:28.004 aoe o arcane_barrage Fluffy_Pillow 45793.2/67366: 68% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(3)
0:28.775 aoe n arcane_explosion Fluffy_Pillow 49526.6/67366: 74% mana bloodlust, clearcasting, temporal_warp, crimson_chorus(3)
0:29.547 aoe n arcane_explosion Fluffy_Pillow 50566.7/67366: 75% mana bloodlust, arcane_charge, temporal_warp, crimson_chorus(3)
0:30.320 aoe n arcane_explosion Fluffy_Pillow 46608.2/67366: 69% mana bloodlust, arcane_charge(2), temporal_warp
0:31.091 aoe n arcane_explosion Fluffy_Pillow 42647.0/67366: 63% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp
0:31.862 aoe o arcane_barrage Fluffy_Pillow 43685.7/67366: 65% mana bloodlust, arcane_charge(4), temporal_warp
0:32.632 aoe n arcane_explosion Fluffy_Pillow 47417.8/67366: 70% mana bloodlust, temporal_warp
0:33.402 aoe n arcane_explosion Fluffy_Pillow 43455.2/67366: 65% mana bloodlust, arcane_charge, temporal_warp
0:34.172 aoe n arcane_explosion Fluffy_Pillow 39492.7/67366: 59% mana bloodlust, arcane_charge(2), temporal_warp
0:34.945 aoe n arcane_explosion Fluffy_Pillow 35534.1/67366: 53% mana bloodlust, arcane_charge(3), temporal_warp
0:35.716 aoe o arcane_barrage Fluffy_Pillow 31572.9/67366: 47% mana bloodlust, arcane_charge(4), temporal_warp
0:36.486 aoe n arcane_explosion Fluffy_Pillow 35305.0/67366: 52% mana bloodlust, temporal_warp
0:37.257 aoe n arcane_explosion Fluffy_Pillow 31343.8/67366: 47% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:38.027 aoe n arcane_explosion Fluffy_Pillow 32381.2/67366: 48% mana bloodlust, arcane_charge(2), temporal_warp
0:38.797 aoe n arcane_explosion Fluffy_Pillow 28418.6/67366: 42% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp
0:39.567 aoe o arcane_barrage Fluffy_Pillow 29456.0/67366: 44% mana bloodlust, arcane_charge(4), temporal_warp
0:40.338 aoe n arcane_explosion Fluffy_Pillow 33189.5/67366: 49% mana bloodlust, temporal_warp
0:41.108 aoe n arcane_explosion Fluffy_Pillow 29226.9/67366: 43% mana arcane_charge, temporal_warp
0:42.109 aoe n arcane_explosion Fluffy_Pillow 25575.5/67366: 38% mana arcane_charge(2)
0:43.409 aoe n arcane_explosion Fluffy_Pillow 22327.1/67366: 33% mana arcane_charge(3), clearcasting
0:44.709 aoe o arcane_barrage Fluffy_Pillow 24078.6/67366: 36% mana arcane_charge(4)
0:46.008 aoe m arcane_orb Fluffy_Pillow 28523.4/67366: 42% mana
0:47.306 aoe o arcane_barrage Fluffy_Pillow 29772.2/67366: 44% mana arcane_charge(4)
0:48.605 aoe n arcane_explosion Fluffy_Pillow 34217.0/67366: 51% mana
0:49.904 aoe n arcane_explosion Fluffy_Pillow 30967.1/67366: 46% mana arcane_charge
0:51.204 aoe n arcane_explosion Fluffy_Pillow 27718.6/67366: 41% mana arcane_charge(2)
0:52.504 aoe n arcane_explosion Fluffy_Pillow 24470.1/67366: 36% mana arcane_charge(3), clearcasting
0:53.804 aoe o arcane_barrage Fluffy_Pillow 26221.6/67366: 39% mana arcane_charge(4)
0:55.103 aoe n arcane_explosion Fluffy_Pillow 30666.4/67366: 46% mana
0:56.404 aoe n arcane_explosion Fluffy_Pillow 27419.3/67366: 41% mana arcane_charge
0:57.705 aoe n arcane_explosion Fluffy_Pillow 24172.1/67366: 36% mana arcane_charge(2)
0:59.004 aoe n arcane_explosion Fluffy_Pillow 20922.3/67366: 31% mana arcane_charge(3), clearcasting
1:00.304 aoe o arcane_barrage Fluffy_Pillow 22673.8/67366: 34% mana arcane_charge(4)
1:01.604 aoe j touch_of_the_magi Fluffy_Pillow 27120.0/67366: 40% mana crimson_chorus
1:02.904 aoe l rune_of_power Fluffy_Pillow 26371.5/67366: 39% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.204 aoe o arcane_barrage Fluffy_Pillow 28123.0/67366: 42% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:05.503 aoe n arcane_explosion Fluffy_Pillow 32567.8/67366: 48% mana clearcasting, rune_of_power, crimson_chorus
1:06.802 aoe n arcane_explosion Fluffy_Pillow 34317.9/67366: 51% mana arcane_charge, rune_of_power, crimson_chorus
1:08.102 aoe n arcane_explosion Fluffy_Pillow 31069.4/67366: 46% mana arcane_charge(2), rune_of_power, crimson_chorus
1:09.403 aoe n arcane_explosion Fluffy_Pillow 27822.3/67366: 41% mana arcane_charge(3), rune_of_power, crimson_chorus
1:10.703 aoe o arcane_barrage Fluffy_Pillow 24573.8/67366: 36% mana arcane_charge(4), rune_of_power, crimson_chorus
1:12.001 aoe m arcane_orb Fluffy_Pillow 29017.2/67366: 43% mana rune_of_power, crimson_chorus(2)
1:13.300 aoe o arcane_barrage Fluffy_Pillow 30267.4/67366: 45% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2)
1:14.599 aoe n arcane_explosion Fluffy_Pillow 34712.2/67366: 52% mana clearcasting, rune_of_power, crimson_chorus(2)
1:15.897 aoe n arcane_explosion Fluffy_Pillow 36461.0/67366: 54% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.194 aoe n arcane_explosion Fluffy_Pillow 33208.5/67366: 49% mana arcane_charge(2), crimson_chorus(2)
1:18.493 aoe n arcane_explosion Fluffy_Pillow 29958.6/67366: 44% mana arcane_charge(3), crimson_chorus(2)
1:19.791 aoe o arcane_barrage Fluffy_Pillow 26707.4/67366: 40% mana arcane_charge(4), crimson_chorus(2)
1:21.092 aoe n arcane_explosion Fluffy_Pillow 31154.9/67366: 46% mana crimson_chorus(3)
1:22.391 aoe n arcane_explosion Fluffy_Pillow 27905.1/67366: 41% mana arcane_charge, clearcasting, crimson_chorus(3)
1:23.690 aoe n arcane_explosion Fluffy_Pillow 29655.3/67366: 44% mana arcane_charge(2), crimson_chorus(3)
1:24.989 aoe n arcane_explosion Fluffy_Pillow 26405.4/67366: 39% mana arcane_charge(3), crimson_chorus(3)
1:26.288 aoe o arcane_barrage Fluffy_Pillow 23155.6/67366: 34% mana arcane_charge(4), crimson_chorus(3)
1:27.588 aoe n arcane_explosion Fluffy_Pillow 27601.7/67366: 41% mana crimson_chorus(3)
1:28.888 aoe n arcane_explosion Fluffy_Pillow 24353.2/67366: 36% mana arcane_charge, clearcasting, crimson_chorus(3)
1:30.186 aoe n arcane_explosion Fluffy_Pillow 26102.0/67366: 39% mana arcane_charge(2), crimson_chorus(3)
1:31.486 aoe n arcane_explosion Fluffy_Pillow 22853.5/67366: 34% mana arcane_charge(3)
1:32.786 aoe o arcane_barrage Fluffy_Pillow 19605.1/67366: 29% mana arcane_charge(4), clearcasting
1:34.086 aoe m arcane_orb Fluffy_Pillow 24051.2/67366: 36% mana clearcasting
1:35.386 aoe o arcane_barrage Fluffy_Pillow 25302.7/67366: 38% mana arcane_charge(4), clearcasting
1:36.686 aoe n arcane_explosion Fluffy_Pillow 29748.8/67366: 44% mana clearcasting
1:37.986 aoe n arcane_explosion Fluffy_Pillow 31500.3/67366: 47% mana arcane_charge
1:39.285 aoe n arcane_explosion Fluffy_Pillow 28250.5/67366: 42% mana arcane_charge(2)
1:40.584 aoe n arcane_explosion Fluffy_Pillow 25000.7/67366: 37% mana arcane_charge(3)
1:41.883 aoe o arcane_barrage Fluffy_Pillow 21750.8/67366: 32% mana arcane_charge(4)
1:43.185 aoe n arcane_explosion Fluffy_Pillow 26199.7/67366: 39% mana
1:44.484 aoe n arcane_explosion Fluffy_Pillow 22949.8/67366: 34% mana arcane_charge
1:45.783 aoe n arcane_explosion Fluffy_Pillow 19700.0/67366: 29% mana arcane_charge(2)
1:47.081 aoe n arcane_explosion Fluffy_Pillow 16448.8/67366: 24% mana arcane_charge(3), clearcasting
1:48.380 aoe o arcane_barrage Fluffy_Pillow 18199.0/67366: 27% mana arcane_charge(4)
1:49.681 aoe j touch_of_the_magi Fluffy_Pillow 22646.4/67366: 34% mana
1:50.981 aoe l rune_of_power Fluffy_Pillow 21898.0/67366: 33% mana arcane_charge(4)
1:52.278 aoe o arcane_barrage Fluffy_Pillow 23645.4/67366: 35% mana arcane_charge(4), rune_of_power
1:53.579 aoe n arcane_explosion Fluffy_Pillow 28092.9/67366: 42% mana rune_of_power
1:54.879 aoe n arcane_explosion Fluffy_Pillow 24844.4/67366: 37% mana arcane_charge, rune_of_power
1:56.178 aoe n arcane_explosion Fluffy_Pillow 21594.6/67366: 32% mana arcane_charge(2), clearcasting, rune_of_power
1:57.475 aoe n arcane_explosion Fluffy_Pillow 23342.0/67366: 35% mana arcane_charge(3), rune_of_power
1:58.773 aoe o arcane_barrage Fluffy_Pillow 20090.9/67366: 30% mana arcane_charge(4), rune_of_power
2:00.073 aoe m arcane_orb Fluffy_Pillow 24537.0/67366: 36% mana rune_of_power
2:01.372 aoe o arcane_barrage Fluffy_Pillow 25787.2/67366: 38% mana arcane_charge(4), rune_of_power
2:02.670 aoe n arcane_explosion Fluffy_Pillow 30230.6/67366: 45% mana rune_of_power, crimson_chorus
2:03.970 aoe n arcane_explosion Fluffy_Pillow 26982.1/67366: 40% mana arcane_charge, rune_of_power, crimson_chorus
2:05.268 aoe n arcane_explosion Fluffy_Pillow 23730.9/67366: 35% mana arcane_charge(2), crimson_chorus
2:06.568 aoe n arcane_explosion Fluffy_Pillow 20482.4/67366: 30% mana arcane_charge(3), clearcasting, crimson_chorus
2:07.869 aoe k arcane_power Fluffy_Pillow 22235.3/67366: 33% mana arcane_charge(4), crimson_chorus
2:07.869 shared_cds r use_items Fluffy_Pillow 22235.3/67366: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:07.869 aoe o arcane_barrage Fluffy_Pillow 22235.3/67366: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.170 aoe n arcane_explosion Fluffy_Pillow 26682.8/67366: 40% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.469 aoe n arcane_explosion Fluffy_Pillow 25932.9/67366: 38% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
2:11.768 aoe n arcane_explosion Fluffy_Pillow 27683.1/67366: 41% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:13.067 aoe n arcane_explosion Fluffy_Pillow 26933.2/67366: 40% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.365 aoe o arcane_barrage Fluffy_Pillow 26182.1/67366: 39% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.665 aoe n arcane_explosion Fluffy_Pillow 30628.2/67366: 45% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.965 aoe n arcane_explosion Fluffy_Pillow 29879.7/67366: 44% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.265 aoe n arcane_explosion Fluffy_Pillow 29131.2/67366: 43% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.565 aoe n arcane_explosion Fluffy_Pillow 28382.7/67366: 42% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.865 shared_cds q use_mana_gem arcane 27634.2/67366: 41% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:21.069 aoe o arcane_barrage Fluffy_Pillow 34645.7/67366: 51% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:22.369 aoe m arcane_orb Fluffy_Pillow 39091.8/67366: 58% mana arcane_power, crimson_chorus(3), gladiators_badge
2:23.666 aoe o arcane_barrage Fluffy_Pillow 40589.3/67366: 60% mana arcane_charge(4), crimson_chorus(3)
2:24.964 aoe n arcane_explosion Fluffy_Pillow 45032.7/67366: 67% mana crimson_chorus(3)
2:26.264 aoe n arcane_explosion Fluffy_Pillow 41784.2/67366: 62% mana arcane_charge, crimson_chorus(3)
2:27.562 aoe n arcane_explosion Fluffy_Pillow 38533.0/67366: 57% mana arcane_charge(2), crimson_chorus(3)
2:28.860 aoe n arcane_explosion Fluffy_Pillow 35281.8/67366: 52% mana arcane_charge(3), crimson_chorus(3)
2:30.160 aoe o arcane_barrage Fluffy_Pillow 32033.3/67366: 48% mana arcane_charge(4), crimson_chorus(3)
2:31.460 aoe n arcane_explosion Fluffy_Pillow 36479.5/67366: 54% mana crimson_chorus(3)
2:32.759 aoe n arcane_explosion Fluffy_Pillow 33229.6/67366: 49% mana arcane_charge
2:34.057 aoe n arcane_explosion Fluffy_Pillow 29978.5/67366: 45% mana arcane_charge(2)
2:35.356 aoe n arcane_explosion Fluffy_Pillow 26728.6/67366: 40% mana arcane_charge(3)
2:36.656 aoe o arcane_barrage Fluffy_Pillow 23480.1/67366: 35% mana arcane_charge(4)
2:37.957 aoe j touch_of_the_magi Fluffy_Pillow 27927.6/67366: 41% mana
2:39.256 aoe l rune_of_power Fluffy_Pillow 27177.8/67366: 40% mana arcane_charge(4)
2:40.555 aoe o arcane_barrage Fluffy_Pillow 28927.9/67366: 43% mana arcane_charge(4), rune_of_power
2:41.856 aoe n arcane_explosion Fluffy_Pillow 33375.4/67366: 50% mana rune_of_power
2:43.156 aoe n arcane_explosion Fluffy_Pillow 30126.9/67366: 45% mana arcane_charge, rune_of_power
2:44.456 aoe n arcane_explosion Fluffy_Pillow 26878.4/67366: 40% mana arcane_charge(2), rune_of_power
2:45.755 aoe n arcane_explosion Fluffy_Pillow 23628.6/67366: 35% mana arcane_charge(3), rune_of_power
2:47.055 aoe o arcane_barrage Fluffy_Pillow 20380.1/67366: 30% mana arcane_charge(4), rune_of_power
2:48.355 aoe m arcane_orb Fluffy_Pillow 24826.2/67366: 37% mana rune_of_power
2:49.654 aoe o arcane_barrage Fluffy_Pillow 26076.4/67366: 39% mana arcane_charge(4), rune_of_power
2:50.953 aoe n arcane_explosion Fluffy_Pillow 30521.2/67366: 45% mana rune_of_power
2:52.254 aoe n arcane_explosion Fluffy_Pillow 27274.1/67366: 40% mana arcane_charge, clearcasting, rune_of_power
2:53.554 aoe n arcane_explosion Fluffy_Pillow 29025.6/67366: 43% mana arcane_charge(2)
2:54.854 aoe n arcane_explosion Fluffy_Pillow 25777.1/67366: 38% mana arcane_charge(3)
2:56.152 aoe o arcane_barrage Fluffy_Pillow 22525.9/67366: 33% mana arcane_charge(4)
2:57.451 aoe n arcane_explosion Fluffy_Pillow 26970.7/67366: 40% mana
2:58.749 aoe n arcane_explosion Fluffy_Pillow 23719.5/67366: 35% mana arcane_charge, clearcasting
3:00.048 aoe n arcane_explosion Fluffy_Pillow 25469.6/67366: 38% mana arcane_charge(2)
3:01.348 aoe n arcane_explosion Fluffy_Pillow 22221.2/67366: 33% mana arcane_charge(3)
3:02.647 aoe o arcane_barrage Fluffy_Pillow 18971.3/67366: 28% mana arcane_charge(4)
3:03.946 aoe n arcane_explosion Fluffy_Pillow 23416.1/67366: 35% mana crimson_chorus
3:05.244 aoe n arcane_explosion Fluffy_Pillow 20164.9/67366: 30% mana arcane_charge, crimson_chorus
3:06.545 aoe n arcane_explosion Fluffy_Pillow 16917.8/67366: 25% mana arcane_charge(2), clearcasting, crimson_chorus
3:07.845 aoe n arcane_explosion Fluffy_Pillow 18669.3/67366: 28% mana arcane_charge(3), crimson_chorus
3:09.145 aoe o arcane_barrage Fluffy_Pillow 15420.8/67366: 23% mana arcane_charge(4), clearcasting, crimson_chorus
3:10.446 aoe m arcane_orb Fluffy_Pillow 19868.3/67366: 29% mana clearcasting, crimson_chorus
3:11.745 aoe o arcane_barrage Fluffy_Pillow 21118.4/67366: 31% mana arcane_charge(4), clearcasting, crimson_chorus
3:13.045 aoe n arcane_explosion Fluffy_Pillow 25564.6/67366: 38% mana clearcasting, crimson_chorus
3:14.345 aoe n arcane_explosion Fluffy_Pillow 27316.1/67366: 41% mana arcane_charge, crimson_chorus(2)
3:15.646 aoe n arcane_explosion Fluffy_Pillow 24068.9/67366: 36% mana arcane_charge(2), crimson_chorus(2)
3:16.945 aoe n arcane_explosion Fluffy_Pillow 20819.1/67366: 31% mana arcane_charge(3), crimson_chorus(2)
3:18.245 aoe o arcane_barrage Fluffy_Pillow 17570.6/67366: 26% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:19.545 aoe n arcane_explosion Fluffy_Pillow 22016.7/67366: 33% mana clearcasting, crimson_chorus(2)
3:20.846 aoe n arcane_explosion Fluffy_Pillow 23769.6/67366: 35% mana arcane_charge, crimson_chorus(2)
3:22.145 aoe n arcane_explosion Fluffy_Pillow 20519.8/67366: 30% mana arcane_charge(2), crimson_chorus(2)
3:23.446 aoe n arcane_explosion Fluffy_Pillow 17272.6/67366: 26% mana arcane_charge(3), crimson_chorus(3)
3:24.748 aoe o arcane_barrage Fluffy_Pillow 14026.8/67366: 21% mana arcane_charge(4), crimson_chorus(3)
3:26.048 aoe j touch_of_the_magi Fluffy_Pillow 18473.0/67366: 27% mana crimson_chorus(3)
3:27.347 aoe l rune_of_power Fluffy_Pillow 17723.1/67366: 26% mana arcane_charge(4), crimson_chorus(3)
3:28.646 aoe o arcane_barrage Fluffy_Pillow 19473.3/67366: 29% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:29.947 aoe n arcane_explosion Fluffy_Pillow 23920.8/67366: 36% mana rune_of_power, crimson_chorus(3)
3:31.247 aoe n arcane_explosion Fluffy_Pillow 20672.3/67366: 31% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:32.547 aoe n arcane_explosion Fluffy_Pillow 17423.8/67366: 26% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
3:33.845 aoe n arcane_explosion Fluffy_Pillow 14172.6/67366: 21% mana arcane_charge(3), rune_of_power
3:35.144 aoe o arcane_barrage Fluffy_Pillow 10922.8/67366: 16% mana arcane_charge(4), rune_of_power
3:36.443 aoe m arcane_orb Fluffy_Pillow 15367.6/67366: 23% mana rune_of_power
3:37.742 aoe o arcane_barrage Fluffy_Pillow 16617.7/67366: 25% mana arcane_charge(4), rune_of_power
3:39.042 aoe n arcane_explosion Fluffy_Pillow 21063.9/67366: 31% mana rune_of_power
3:40.343 aoe n arcane_explosion Fluffy_Pillow 17816.7/67366: 26% mana arcane_charge, rune_of_power
3:41.642 aoe n arcane_explosion Fluffy_Pillow 14566.9/67366: 22% mana arcane_charge(2)
3:42.942 aoe n arcane_explosion Fluffy_Pillow 11318.4/67366: 17% mana arcane_charge(3)
3:44.241 aoe o arcane_barrage Fluffy_Pillow 8068.5/67366: 12% mana arcane_charge(4)
3:45.541 aoe n arcane_explosion Fluffy_Pillow 12514.7/67366: 19% mana
3:46.840 aoe n arcane_explosion Fluffy_Pillow 9264.8/67366: 14% mana arcane_charge
3:48.140 aoe n arcane_explosion Fluffy_Pillow 6016.3/67366: 9% mana arcane_charge(2)
3:49.438 aoe p evocation arcane 2765.2/67366: 4% mana arcane_charge(3)
3:53.757 aoe n arcane_explosion Fluffy_Pillow 59973.5/67366: 89% mana arcane_charge(3)
3:55.058 aoe o arcane_barrage Fluffy_Pillow 56726.3/67366: 84% mana arcane_charge(4), clearcasting
3:56.355 aoe m arcane_orb Fluffy_Pillow 61168.4/67366: 91% mana clearcasting
3:57.742 aoe o arcane_barrage Fluffy_Pillow 62537.1/67366: 93% mana arcane_charge(4), clearcasting
3:59.042 aoe n arcane_explosion Fluffy_Pillow 66983.3/67366: 99% mana clearcasting
4:00.344 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge
4:01.644 aoe n arcane_explosion Fluffy_Pillow 64117.2/67366: 95% mana arcane_charge(2)
4:02.945 aoe n arcane_explosion Fluffy_Pillow 60870.1/67366: 90% mana arcane_charge(3)
4:04.244 aoe o arcane_barrage Fluffy_Pillow 57620.2/67366: 86% mana arcane_charge(4)
4:05.543 aoe n arcane_explosion Fluffy_Pillow 62065.0/67366: 92% mana crimson_chorus
4:06.841 aoe n arcane_explosion Fluffy_Pillow 58813.8/67366: 87% mana arcane_charge, crimson_chorus
4:08.142 aoe n arcane_explosion Fluffy_Pillow 55566.7/67366: 82% mana arcane_charge(2), crimson_chorus
4:09.444 aoe n arcane_explosion Fluffy_Pillow 52320.9/67366: 78% mana arcane_charge(3), crimson_chorus
4:10.745 aoe o arcane_barrage Fluffy_Pillow 49073.8/67366: 73% mana arcane_charge(4), crimson_chorus
4:12.045 aoe n arcane_explosion Fluffy_Pillow 53519.9/67366: 79% mana crimson_chorus
4:13.346 aoe j touch_of_the_magi Fluffy_Pillow 50272.8/67366: 75% mana arcane_charge, clearcasting, crimson_chorus
4:14.645 aoe k arcane_power Fluffy_Pillow 49522.9/67366: 74% mana arcane_charge(4), clearcasting, crimson_chorus
4:14.645 shared_cds r use_items Fluffy_Pillow 49522.9/67366: 74% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus
4:14.645 shared_cds u berserking Fluffy_Pillow 49522.9/67366: 74% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:14.645 aoe o arcane_barrage Fluffy_Pillow 49522.9/67366: 74% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:15.828 aoe n arcane_explosion Fluffy_Pillow 53811.4/67366: 80% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.011 aoe n arcane_explosion Fluffy_Pillow 55405.3/67366: 82% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.193 aoe n arcane_explosion Fluffy_Pillow 54497.8/67366: 81% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.375 aoe n arcane_explosion Fluffy_Pillow 53590.3/67366: 80% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.557 aoe o arcane_barrage Fluffy_Pillow 52682.9/67366: 78% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.740 shared_cds q use_mana_gem arcane 56971.4/67366: 85% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.740 aoe m arcane_orb Fluffy_Pillow 63707.9/67366: 95% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.923 aoe o arcane_barrage Fluffy_Pillow 65051.8/67366: 97% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.105 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:25.286 aoe n arcane_explosion Fluffy_Pillow 66456.9/67366: 99% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.468 aoe n arcane_explosion Fluffy_Pillow 65549.4/67366: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.652 aoe n arcane_explosion Fluffy_Pillow 64644.6/67366: 96% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:28.952 aoe l rune_of_power Fluffy_Pillow 63896.1/67366: 95% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:30.251 aoe o arcane_barrage Fluffy_Pillow 65646.3/67366: 97% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:31.548 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power, crimson_chorus(3)
4:32.846 aoe n arcane_explosion Fluffy_Pillow 64114.5/67366: 95% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:34.145 aoe n arcane_explosion Fluffy_Pillow 60864.7/67366: 90% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
4:35.444 aoe n arcane_explosion Fluffy_Pillow 57614.9/67366: 86% mana arcane_charge(3), rune_of_power
4:36.743 aoe o arcane_barrage Fluffy_Pillow 54365.0/67366: 81% mana arcane_charge(4), rune_of_power
4:38.042 aoe n arcane_explosion Fluffy_Pillow 58809.8/67366: 87% mana rune_of_power
4:39.342 aoe n arcane_explosion Fluffy_Pillow 55561.3/67366: 82% mana arcane_charge, rune_of_power
4:40.641 aoe n arcane_explosion Fluffy_Pillow 52311.5/67366: 78% mana arcane_charge(2), rune_of_power
4:41.940 aoe n arcane_explosion Fluffy_Pillow 49061.6/67366: 73% mana arcane_charge(3), rune_of_power
4:43.240 aoe o arcane_barrage Fluffy_Pillow 45813.1/67366: 68% mana arcane_charge(4)
4:44.540 aoe m arcane_orb Fluffy_Pillow 50259.3/67366: 75% mana
4:45.839 aoe o arcane_barrage Fluffy_Pillow 51509.4/67366: 76% mana arcane_charge(4)
4:47.139 aoe n arcane_explosion Fluffy_Pillow 55955.6/67366: 83% mana
4:48.438 aoe n arcane_explosion Fluffy_Pillow 52705.7/67366: 78% mana arcane_charge
4:49.739 aoe n arcane_explosion Fluffy_Pillow 49458.6/67366: 73% mana arcane_charge(2)
4:51.040 aoe n arcane_explosion Fluffy_Pillow 46211.5/67366: 69% mana arcane_charge(3)
4:52.339 aoe o arcane_barrage Fluffy_Pillow 42961.6/67366: 64% mana arcane_charge(4), clearcasting
4:53.639 aoe n arcane_explosion Fluffy_Pillow 47407.7/67366: 70% mana clearcasting
4:54.939 aoe n arcane_explosion Fluffy_Pillow 49159.3/67366: 73% mana arcane_charge
4:56.238 aoe n arcane_explosion Fluffy_Pillow 45909.4/67366: 68% mana arcane_charge(2), clearcasting
4:57.537 aoe n arcane_explosion Fluffy_Pillow 47659.6/67366: 71% mana arcane_charge(3)
4:58.837 aoe o arcane_barrage Fluffy_Pillow 44411.1/67366: 66% mana arcane_charge(4)
5:00.137 aoe n arcane_explosion Fluffy_Pillow 48857.2/67366: 73% mana
5:01.437 shared_cds t time_warp Fluffy_Pillow 45608.7/67366: 68% mana arcane_charge
5:01.437 aoe n arcane_explosion Fluffy_Pillow 43608.7/67366: 65% mana arcane_charge, temporal_warp
5:02.439 aoe n arcane_explosion Fluffy_Pillow 39958.7/67366: 59% mana arcane_charge(2), clearcasting, temporal_warp
5:03.439 aoe n arcane_explosion Fluffy_Pillow 41306.1/67366: 61% mana arcane_charge(3), temporal_warp
5:04.441 aoe o arcane_barrage Fluffy_Pillow 37656.1/67366: 56% mana arcane_charge(4), temporal_warp
5:05.440 aoe m arcane_orb Fluffy_Pillow 41696.7/67366: 62% mana temporal_warp, crimson_chorus
5:06.440 aoe o arcane_barrage Fluffy_Pillow 42544.0/67366: 63% mana arcane_charge(4), temporal_warp, crimson_chorus
5:07.440 aoe n arcane_explosion Fluffy_Pillow 46585.9/67366: 69% mana temporal_warp, crimson_chorus
5:08.440 aoe n arcane_explosion Fluffy_Pillow 42933.2/67366: 64% mana arcane_charge, temporal_warp, crimson_chorus
5:09.441 aoe n arcane_explosion Fluffy_Pillow 39281.9/67366: 58% mana arcane_charge(2), temporal_warp, crimson_chorus
5:10.442 aoe n arcane_explosion Fluffy_Pillow 35630.6/67366: 53% mana arcane_charge(3), temporal_warp, crimson_chorus
5:11.443 aoe o arcane_barrage Fluffy_Pillow 31979.2/67366: 47% mana arcane_charge(4), temporal_warp, crimson_chorus
5:12.443 aoe n arcane_explosion Fluffy_Pillow 36021.2/67366: 53% mana temporal_warp, crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

disciplinary_command : 12996 dps, 3726 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12995.9 12995.9 20.1 / 0.154% 1237.4 / 9.5% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2047.4 1952.7 Mana 0.00% 51.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
disciplinary_command 12996
Arcane Barrage 5277 40.6% 55.9 5.34sec 28167 23496 Direct 279.3 4622 10177 5644 18.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.94 279.28 0.00 0.00 1.1988 0.0000 1575582.99 1575582.99 0.00% 23496.17 23496.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.62% 227.94 175 293 4622.34 2560 17288 4621.72 4283 4946 1053372 1053372 0.00%
crit 18.38% 51.34 29 84 10176.52 5121 39762 10175.82 7577 14003 522211 522211 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:55.94
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 5757 44.3% 152.1 1.93sec 11298 9436 Direct 760.6 1855 4021 2260 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.12 760.59 0.00 0.00 1.1973 0.0000 1718654.65 1718654.65 0.00% 9436.47 9436.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.28% 618.20 478 765 1854.75 1391 3757 1853.83 1762 1947 1146273 1146273 0.00%
crit 18.72% 142.40 95 190 4021.01 2782 8641 4019.87 3590 4653 572382 572382 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:152.14
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1091) 0.0% (8.4%) 13.0 23.65sec 25059 20822

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.02 0.00 0.00 0.00 1.2035 0.0000 0.00 0.00 0.00% 20821.99 20821.99

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:13.02
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1091 8.4% 65.0 23.66sec 5021 0 Direct 65.0 4090 9184 5021 18.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.96 64.96 0.00 0.00 0.0000 0.0000 326155.61 326155.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.70% 53.07 36 72 4089.73 2749 7425 4089.30 3435 4491 216960 216960 0.00%
crit 18.30% 11.89 2 24 9184.16 5498 17077 9187.33 5906 12720 109196 109196 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (73) 0.0% (0.6%) 15.0 1.70sec 1429 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 73 0.6% 15.0 1.70sec 1429 0 Direct 15.0 1137 2513 1429 21.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.00 15.00 0.00 0.00 0.0000 0.0000 21430.21 21430.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.80% 11.82 4 21 1136.91 1117 1184 1137.14 1117 1178 13437 13437 0.00%
crit 21.20% 3.18 0 8 2513.38 2233 2723 2418.48 0 2723 7993 7993 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.3% 20.7 13.91sec 558 0 Direct 20.7 464 979 558 18.3%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.71 20.71 0.00 0.00 0.0000 0.0000 11566.37 11566.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.67% 16.92 6 31 464.10 453 481 464.10 453 475 7851 7851 0.00%
crit 18.33% 3.80 0 13 978.98 907 1106 952.24 0 1106 3715 3715 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Fire Blast 34 0.3% 6.0 51.39sec 1697 1345 Direct 6.0 1455 2908 1699 16.7%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 6.01 0.00 0.00 1.2615 0.0000 10198.00 10198.00 0.00% 1345.20 1345.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.34% 5.01 0 7 1454.87 1442 1529 1453.40 0 1507 7288 7288 0.00%
crit 16.66% 1.00 0 5 2907.70 2885 3058 1880.34 0 3058 2910 2910 0.00%

Action Details: Fire Blast

  • id:319836
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.720000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:319836
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage.$?a231568[ |cFFFFFFFFFire:|r Always deals a critical strike.][]

Action Priority List

    aoe
    [k]:6.01
  • if_expr:(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
Frostbolt 25 0.2% 5.0 51.39sec 1517 902 Direct 6.0 1032 2376 1266 17.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.01 6.01 0.00 0.00 1.6815 0.0000 7602.06 7602.06 0.00% 902.43 902.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 4.96 1 7 1032.32 1024 1085 1032.31 1024 1085 5125 5125 0.00%
crit 17.35% 1.04 0 5 2376.23 2354 2496 1615.29 0 2496 2477 2477 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.

Action Priority List

    aoe
    [j]:5.04
  • if_expr:runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
Mirror Image 0 (15) 0.0% (0.1%) 1.0 0.00sec 4535 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 113  / 15 0.1% 93.0 1.25sec 49 39 Direct 93.0 41 82 49 19.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2644 0.0000 4535.35 4535.35 0.00% 38.57 38.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 74.79 60 84 40.58 30 51 40.58 39 42 3035 3035 0.00%
crit 19.58% 18.21 9 33 82.38 59 101 82.43 72 93 1500 1500 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (684) 0.0% (5.3%) 6.0 54.09sec 34142 28148

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.98 0.00 0.00 0.00 1.2130 0.0000 0.00 0.00 0.00% 28148.10 28148.10

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [l]:6.00
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 684 5.3% 6.0 53.97sec 34142 0 Direct 29.8 6853 0 6853 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.98 29.79 0.00 0.00 0.0000 0.0000 204045.58 204045.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.79 25 35 6852.85 1002 38656 6848.36 5064 9077 204046 204046 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14601.75
  • base_dd_max:14601.75
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
disciplinary_command
Arcane Power 2.8 130.97sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [m]:2.78
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 262.15sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.78
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 176.80sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.94 0.00 5.61 0.00 4.1746 0.6977 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:disciplinary_command
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:0.94
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:disciplinary_command
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:disciplinary_command
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.02sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.84 0.00 0.00 0.00 1.2119 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [n]:5.87
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 122.71sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:disciplinary_command
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.7 179.4 5.3sec 1.3sec 3.8sec 72.20% 0.00% 27.7 (28.4) 0.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.2s

Stack Uptimes

  • arcane_charge_1:19.52%
  • arcane_charge_2:16.66%
  • arcane_charge_3:15.67%
  • arcane_charge_4:20.35%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.3sec 131.3sec 14.6sec 13.58% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.5s / 136.9s
  • trigger_min/max:121.5s / 136.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.58%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.6sec 262.6sec 11.6sec 6.84% 17.13% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.7s / 268.3s
  • trigger_min/max:249.7s / 268.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.84%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.2 0.2 11.9sec 11.8sec 2.0sec 16.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.29%
  • clearcasting_2:0.32%
  • clearcasting_3:0.07%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.7sec 60.5sec 28.7sec 52.04% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.1s / 64.8s
  • trigger_min/max:60.1s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.35%
  • crimson_chorus_3:16.75%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Disciplinary Command 6.0 0.0 53.9sec 51.1sec 19.5sec 39.21% 0.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_disciplinary_command
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:30.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:49.6s / 67.9s
  • trigger_min/max:49.6s / 67.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • disciplinary_command_1:39.21%

Spelldata

  • id:327371
  • name:Disciplinary Command
  • tooltip:Critical Strike damage increased by $w1%.
  • description:{$@spelldesc327365=Casting a Frost, Fire and Arcane spell within {$327366d=10 seconds} of each other increases your Critical Strike damage of all your spells by {$327371s1=15}%. This effect can only occur once every {$327371s2=30} sec.}
  • max_stacks:0
  • duration:20.00
  • cooldown:30.00
  • default_chance:0.00%
Evocation 0.9 0.0 168.9sec 168.9sec 4.2sec 1.32% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:121.1s / 259.9s
  • trigger_min/max:121.1s / 259.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.2s

Stack Uptimes

  • evocation_1:1.32%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.8 0.0 131.3sec 131.3sec 14.6sec 13.58% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.5s / 136.9s
  • trigger_min/max:121.5s / 136.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:13.58%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.0sec 36.0sec 11.8sec 33.99% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.9s / 55.1s
  • trigger_min/max:13.9s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.99%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.42% 0.87% 7.01% 1.0s 0.0s 5.8s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation169.80831.087349.616228.961150.173359.329
Rune of Power7.7073.34022.71146.53731.54060.564
Touch of the Magi6.5861.25921.59740.89330.28059.302
Arcane Power8.0281.51716.91222.9353.78030.553
Arcane Barrage2.9340.00310.943165.310132.072200.181
Arcane Orb3.6440.75212.44047.65538.13460.338
Fire Blast36.9770.00058.479242.042192.661292.831

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
disciplinary_command
mana_regen Mana 539.82 378598.11 64.92% 701.35 11432.95 2.93%
Evocation Mana 42.91 46700.41 8.01% 1088.26 0.00 0.00%
Mana Gem Mana 2.74 17928.04 3.07% 6539.43 0.00 0.00%
Arcane Barrage Mana 55.94 139963.02 24.00% 2501.93 6368.25 4.35%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 64394.3 1952.73 2047.39 17828.5 37122.4 136.2 65394.3
Usage Type Count Total Avg RPE APR
disciplinary_command
arcane_explosion Mana 152.1 581677.2 3823.3 3823.8 3.0
arcane_orb Mana 13.0 5844.1 449.0 449.0 55.8
fire_blast Mana 6.0 3004.8 500.0 500.0 3.4
frostbolt Mana 6.0 6009.7 1000.0 1199.6 1.3
touch_of_the_magi Mana 6.0 14941.9 2500.0 2500.2 13.7

Statistics & Data Analysis

Fight Length
disciplinary_command Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
disciplinary_command Damage Per Second
Count 1017
Mean 12995.87
Minimum 12144.18
Maximum 13948.76
Spread ( max - min ) 1804.58
Range [ ( max - min ) / 2 * 100% ] 6.94%
Standard Deviation 326.6248
5th Percentile 12504.72
95th Percentile 13557.54
( 95th Percentile - 5th Percentile ) 1052.83
Mean Distribution
Standard Deviation 10.2421
95.00% Confidence Interval ( 12975.80 - 13015.94 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2427
0.1 Scale Factor Error with Delta=300 911
0.05 Scale Factor Error with Delta=300 3643
0.01 Scale Factor Error with Delta=300 91072
Priority Target DPS
disciplinary_command Priority Target Damage Per Second
Count 1017
Mean 3725.89
Minimum 3304.49
Maximum 4299.52
Spread ( max - min ) 995.04
Range [ ( max - min ) / 2 * 100% ] 13.35%
Standard Deviation 158.4288
5th Percentile 3472.89
95th Percentile 4012.03
( 95th Percentile - 5th Percentile ) 539.14
Mean Distribution
Standard Deviation 4.9679
95.00% Confidence Interval ( 3716.15 - 3735.62 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6946
0.1 Scale Factor Error with Delta=300 215
0.05 Scale Factor Error with Delta=300 858
0.01 Scale Factor Error with Delta=300 21427
DPS(e)
disciplinary_command Damage Per Second (Effective)
Count 1017
Mean 12995.87
Minimum 12144.18
Maximum 13948.76
Spread ( max - min ) 1804.58
Range [ ( max - min ) / 2 * 100% ] 6.94%
Damage
disciplinary_command Damage
Count 1017
Mean 3875235.47
Minimum 3031993.72
Maximum 4756884.88
Spread ( max - min ) 1724891.16
Range [ ( max - min ) / 2 * 100% ] 22.26%
DTPS
disciplinary_command Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
disciplinary_command Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
disciplinary_command Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
disciplinary_command Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
disciplinary_command Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
disciplinary_command Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
disciplinary_commandTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
disciplinary_command Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
j 5.04 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
k 6.01 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
l 6.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
m 2.78 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
n 5.87 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 13.02 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 152.14 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 55.94 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 0.94 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
s 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
t 2.78 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.78 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABCGIJLMNPQRVXYklmtuvqoqppppqppppqppppnqpppspqoqppppqppppqppppqppppqoqppppqppppqpjklnqoqppppqppppqppppqoqppppqppppqppppqjklnqoqppppqppppmtqppppqosqppppqppppqppppqjklnqoqppppqppppqppppqoqppppqppprpqppjklnqoqppppqppppqppppqoqppppqppppqppppqsjklmtvqoqppppqppppnqppppqoqppppqppppqppppqoq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat C totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat J ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat N am_spam Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Q flask disciplinary_command 65394.3/65394: 100% mana
Pre precombat R food disciplinary_command 65394.3/65394: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 65394.3/65394: 100% mana
0:00.000 aoe k fire_blast Fluffy_Pillow 64394.3/65394: 98% mana
0:01.263 aoe l touch_of_the_magi Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, disciplinary_command, crimson_chorus
0:02.234 aoe m arcane_power Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), disciplinary_command, crimson_chorus
0:02.234 shared_cds t use_items Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus
0:02.234 shared_cds u potion Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, gladiators_badge
0:02.234 shared_cds v berserking Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.234 aoe q arcane_barrage Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.118 aoe o arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.001 aoe q arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.885 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.768 aoe p arcane_explosion Fluffy_Pillow 64049.1/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.650 aoe p arcane_explosion Fluffy_Pillow 65202.7/65394: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.533 aoe p arcane_explosion Fluffy_Pillow 63857.6/65394: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.418 aoe q arcane_barrage Fluffy_Pillow 62515.0/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.302 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, disciplinary_command, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.184 aoe p arcane_explosion Fluffy_Pillow 64047.8/65394: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.067 aoe p arcane_explosion Fluffy_Pillow 62702.7/65394: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.952 aoe p arcane_explosion Fluffy_Pillow 61360.2/65394: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.835 aoe q arcane_barrage Fluffy_Pillow 60015.0/65394: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.718 aoe p arcane_explosion Fluffy_Pillow 63785.7/65394: 98% mana bloodlust, berserking, arcane_power, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.601 aoe p arcane_explosion Fluffy_Pillow 62440.5/65394: 95% mana bloodlust, arcane_charge, arcane_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.572 aoe p arcane_explosion Fluffy_Pillow 61210.5/65394: 94% mana bloodlust, arcane_charge(2), arcane_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.542 aoe p arcane_explosion Fluffy_Pillow 59979.1/65394: 92% mana bloodlust, arcane_charge(3), arcane_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.514 aoe n rune_of_power Fluffy_Pillow 58750.4/65394: 90% mana bloodlust, arcane_charge(4), disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation
0:18.487 aoe q arcane_barrage Fluffy_Pillow 60023.0/65394: 92% mana bloodlust, arcane_charge(4), rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation
0:19.456 aoe p arcane_explosion Fluffy_Pillow 63906.1/65394: 98% mana bloodlust, rune_of_power, disciplinary_command, crimson_chorus(2), potion_of_deathly_fixation
0:20.428 aoe p arcane_explosion Fluffy_Pillow 60177.4/65394: 92% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.399 aoe p arcane_explosion Fluffy_Pillow 56447.3/65394: 86% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.372 shared_cds s use_mana_gem disciplinary_command 52719.9/65394: 81% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.372 aoe p arcane_explosion Fluffy_Pillow 59259.3/65394: 91% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.344 aoe q arcane_barrage Fluffy_Pillow 60530.6/65394: 93% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.316 aoe o arcane_orb Fluffy_Pillow 64417.6/65394: 99% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.288 aoe q arcane_barrage Fluffy_Pillow 65188.9/65394: 100% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.259 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.231 aoe p arcane_explosion Fluffy_Pillow 61665.6/65394: 94% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:28.202 aoe p arcane_explosion Fluffy_Pillow 57935.5/65394: 89% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:29.173 aoe p arcane_explosion Fluffy_Pillow 54205.5/65394: 83% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3)
0:30.144 aoe q arcane_barrage Fluffy_Pillow 55475.4/65394: 85% mana bloodlust, arcane_charge(4), rune_of_power
0:31.117 aoe p arcane_explosion Fluffy_Pillow 59363.8/65394: 91% mana bloodlust
0:32.088 aoe p arcane_explosion Fluffy_Pillow 55633.7/65394: 85% mana bloodlust, arcane_charge, clearcasting
0:33.061 aoe p arcane_explosion Fluffy_Pillow 56906.3/65394: 87% mana bloodlust, arcane_charge(2)
0:34.032 aoe p arcane_explosion Fluffy_Pillow 53176.3/65394: 81% mana bloodlust, arcane_charge(3), clearcasting
0:35.005 aoe q arcane_barrage Fluffy_Pillow 54448.8/65394: 83% mana bloodlust, arcane_charge(4)
0:35.977 aoe p arcane_explosion Fluffy_Pillow 58335.9/65394: 89% mana bloodlust
0:36.948 aoe p arcane_explosion Fluffy_Pillow 54605.8/65394: 84% mana bloodlust, arcane_charge
0:37.919 aoe p arcane_explosion Fluffy_Pillow 50875.8/65394: 78% mana bloodlust, arcane_charge(2), clearcasting
0:38.889 aoe p arcane_explosion Fluffy_Pillow 52144.4/65394: 80% mana bloodlust, arcane_charge(3)
0:39.860 aoe q arcane_barrage Fluffy_Pillow 48414.4/65394: 74% mana bloodlust, arcane_charge(4)
0:40.834 aoe p arcane_explosion Fluffy_Pillow 52304.0/65394: 80% mana bloodlust
0:41.805 aoe p arcane_explosion Fluffy_Pillow 48574.0/65394: 74% mana arcane_charge
0:43.067 aoe p arcane_explosion Fluffy_Pillow 45224.5/65394: 69% mana arcane_charge(2)
0:44.328 aoe p arcane_explosion Fluffy_Pillow 41873.8/65394: 64% mana arcane_charge(3), clearcasting
0:45.591 aoe q arcane_barrage Fluffy_Pillow 43525.6/65394: 67% mana arcane_charge(4)
0:46.853 aoe o arcane_orb Fluffy_Pillow 47792.0/65394: 73% mana
0:48.114 aoe q arcane_barrage Fluffy_Pillow 48941.2/65394: 75% mana arcane_charge(4)
0:49.376 aoe p arcane_explosion Fluffy_Pillow 53207.5/65394: 81% mana
0:50.637 aoe p arcane_explosion Fluffy_Pillow 49856.8/65394: 76% mana arcane_charge
0:51.897 aoe p arcane_explosion Fluffy_Pillow 46504.7/65394: 71% mana arcane_charge(2)
0:53.159 aoe p arcane_explosion Fluffy_Pillow 43155.3/65394: 66% mana arcane_charge(3)
0:54.421 aoe q arcane_barrage Fluffy_Pillow 39805.8/65394: 61% mana arcane_charge(4)
0:55.682 aoe p arcane_explosion Fluffy_Pillow 44070.8/65394: 67% mana
0:56.943 aoe p arcane_explosion Fluffy_Pillow 40720.1/65394: 62% mana arcane_charge
0:58.206 aoe p arcane_explosion Fluffy_Pillow 37371.9/65394: 57% mana arcane_charge(2)
0:59.470 aoe p arcane_explosion Fluffy_Pillow 34025.1/65394: 52% mana arcane_charge(3)
1:00.731 aoe q arcane_barrage Fluffy_Pillow 30674.4/65394: 47% mana arcane_charge(4)
1:01.993 aoe p arcane_explosion Fluffy_Pillow 34940.7/65394: 53% mana crimson_chorus
1:03.255 aoe j frostbolt Fluffy_Pillow 31591.2/65394: 48% mana arcane_charge, clearcasting, crimson_chorus
1:04.936 aoe k fire_blast Fluffy_Pillow 32789.8/65394: 50% mana arcane_charge, clearcasting, crimson_chorus
1:06.196 aoe l touch_of_the_magi Fluffy_Pillow 33937.7/65394: 52% mana arcane_charge, clearcasting, disciplinary_command, crimson_chorus
1:07.458 aoe n rune_of_power Fluffy_Pillow 33088.3/65394: 51% mana arcane_charge(4), clearcasting, disciplinary_command, crimson_chorus
1:08.719 aoe q arcane_barrage Fluffy_Pillow 34737.5/65394: 53% mana arcane_charge(4), clearcasting, rune_of_power, disciplinary_command, crimson_chorus
1:09.979 aoe o arcane_orb Fluffy_Pillow 39001.2/65394: 60% mana clearcasting, rune_of_power, disciplinary_command, crimson_chorus
1:11.240 aoe q arcane_barrage Fluffy_Pillow 40150.5/65394: 61% mana arcane_charge(4), clearcasting, rune_of_power, disciplinary_command, crimson_chorus(2)
1:12.501 aoe p arcane_explosion Fluffy_Pillow 44415.5/65394: 68% mana clearcasting, rune_of_power, disciplinary_command, crimson_chorus(2)
1:13.764 aoe p arcane_explosion Fluffy_Pillow 46067.3/65394: 70% mana arcane_charge, rune_of_power, disciplinary_command, crimson_chorus(2)
1:15.025 aoe p arcane_explosion Fluffy_Pillow 42716.6/65394: 65% mana arcane_charge(2), rune_of_power, disciplinary_command, crimson_chorus(2)
1:16.287 aoe p arcane_explosion Fluffy_Pillow 39367.1/65394: 60% mana arcane_charge(3), clearcasting, rune_of_power, disciplinary_command, crimson_chorus(2)
1:17.550 aoe q arcane_barrage Fluffy_Pillow 41019.0/65394: 63% mana arcane_charge(4), rune_of_power, disciplinary_command, crimson_chorus(2)
1:18.812 aoe p arcane_explosion Fluffy_Pillow 45285.3/65394: 69% mana rune_of_power, disciplinary_command, crimson_chorus(2)
1:20.074 aoe p arcane_explosion Fluffy_Pillow 41935.9/65394: 64% mana arcane_charge, rune_of_power, disciplinary_command, crimson_chorus(2)
1:21.335 aoe p arcane_explosion Fluffy_Pillow 38585.1/65394: 59% mana arcane_charge(2), disciplinary_command, crimson_chorus(3)
1:22.597 aoe p arcane_explosion Fluffy_Pillow 35235.7/65394: 54% mana arcane_charge(3), disciplinary_command, crimson_chorus(3)
1:23.858 aoe q arcane_barrage Fluffy_Pillow 31884.9/65394: 49% mana arcane_charge(4), disciplinary_command, crimson_chorus(3)
1:25.118 aoe p arcane_explosion Fluffy_Pillow 36148.6/65394: 55% mana crimson_chorus(3)
1:26.378 aoe p arcane_explosion Fluffy_Pillow 32796.6/65394: 50% mana arcane_charge, clearcasting, crimson_chorus(3)
1:27.639 aoe p arcane_explosion Fluffy_Pillow 34445.8/65394: 53% mana arcane_charge(2), crimson_chorus(3)
1:28.900 aoe p arcane_explosion Fluffy_Pillow 31095.0/65394: 48% mana arcane_charge(3), crimson_chorus(3)
1:30.162 aoe q arcane_barrage Fluffy_Pillow 27745.6/65394: 42% mana arcane_charge(4), crimson_chorus(3)
1:31.423 aoe o arcane_orb Fluffy_Pillow 32010.6/65394: 49% mana
1:32.684 aoe q arcane_barrage Fluffy_Pillow 33159.9/65394: 51% mana arcane_charge(4)
1:33.946 aoe p arcane_explosion Fluffy_Pillow 37426.2/65394: 57% mana
1:35.208 aoe p arcane_explosion Fluffy_Pillow 34076.7/65394: 52% mana arcane_charge
1:36.468 aoe p arcane_explosion Fluffy_Pillow 30724.7/65394: 47% mana arcane_charge(2)
1:37.729 aoe p arcane_explosion Fluffy_Pillow 27373.9/65394: 42% mana arcane_charge(3)
1:38.992 aoe q arcane_barrage Fluffy_Pillow 24025.8/65394: 37% mana arcane_charge(4)
1:40.253 aoe p arcane_explosion Fluffy_Pillow 28290.8/65394: 43% mana
1:41.516 aoe p arcane_explosion Fluffy_Pillow 24942.6/65394: 38% mana arcane_charge
1:42.777 aoe p arcane_explosion Fluffy_Pillow 21591.9/65394: 33% mana arcane_charge(2)
1:44.040 aoe p arcane_explosion Fluffy_Pillow 18243.7/65394: 28% mana arcane_charge(3)
1:45.301 aoe q arcane_barrage Fluffy_Pillow 14893.0/65394: 23% mana arcane_charge(4)
1:46.563 aoe p arcane_explosion Fluffy_Pillow 19159.3/65394: 29% mana
1:47.824 aoe p arcane_explosion Fluffy_Pillow 15808.6/65394: 24% mana arcane_charge, clearcasting
1:49.084 aoe p arcane_explosion Fluffy_Pillow 17456.5/65394: 27% mana arcane_charge(2)
1:50.346 aoe p arcane_explosion Fluffy_Pillow 14107.0/65394: 22% mana arcane_charge(3)
1:51.609 aoe q arcane_barrage Fluffy_Pillow 10758.9/65394: 16% mana arcane_charge(4)
1:52.870 aoe j frostbolt Fluffy_Pillow 15023.9/65394: 23% mana
1:54.552 aoe k fire_blast Fluffy_Pillow 16223.8/65394: 25% mana
1:55.811 aoe l touch_of_the_magi Fluffy_Pillow 17370.4/65394: 27% mana disciplinary_command
1:57.070 aoe n rune_of_power Fluffy_Pillow 16517.0/65394: 25% mana arcane_charge(4), disciplinary_command
1:58.331 aoe q arcane_barrage Fluffy_Pillow 18166.3/65394: 28% mana arcane_charge(4), rune_of_power, disciplinary_command
1:59.592 aoe o arcane_orb Fluffy_Pillow 22431.3/65394: 34% mana rune_of_power, disciplinary_command
2:00.853 aoe q arcane_barrage Fluffy_Pillow 23580.5/65394: 36% mana arcane_charge(4), rune_of_power, disciplinary_command
2:02.114 aoe p arcane_explosion Fluffy_Pillow 27845.6/65394: 43% mana rune_of_power, disciplinary_command, crimson_chorus
2:03.377 aoe p arcane_explosion Fluffy_Pillow 24497.4/65394: 37% mana arcane_charge, rune_of_power, disciplinary_command, crimson_chorus
2:04.639 aoe p arcane_explosion Fluffy_Pillow 21148.0/65394: 32% mana arcane_charge(2), rune_of_power, disciplinary_command, crimson_chorus
2:05.900 aoe p arcane_explosion Fluffy_Pillow 17797.2/65394: 27% mana arcane_charge(3), rune_of_power, disciplinary_command, crimson_chorus
2:07.160 aoe q arcane_barrage Fluffy_Pillow 14445.1/65394: 22% mana arcane_charge(4), rune_of_power, disciplinary_command, crimson_chorus
2:08.422 aoe p arcane_explosion Fluffy_Pillow 18711.5/65394: 29% mana rune_of_power, disciplinary_command, crimson_chorus
2:09.684 aoe p arcane_explosion Fluffy_Pillow 15362.0/65394: 23% mana arcane_charge, rune_of_power, disciplinary_command, crimson_chorus
2:10.946 aoe p arcane_explosion Fluffy_Pillow 12012.6/65394: 18% mana arcane_charge(2), disciplinary_command, crimson_chorus
2:12.206 aoe p arcane_explosion Fluffy_Pillow 8660.5/65394: 13% mana arcane_charge(3), disciplinary_command, crimson_chorus(2)
2:13.468 aoe m arcane_power Fluffy_Pillow 5311.1/65394: 8% mana arcane_charge(4), clearcasting, disciplinary_command, crimson_chorus(2)
2:13.468 shared_cds t use_items Fluffy_Pillow 5311.1/65394: 8% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(2)
2:13.468 aoe q arcane_barrage Fluffy_Pillow 5311.1/65394: 8% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(2), gladiators_badge
2:14.729 aoe p arcane_explosion Fluffy_Pillow 9576.1/65394: 15% mana arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.990 aoe p arcane_explosion Fluffy_Pillow 11225.3/65394: 17% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.250 aoe p arcane_explosion Fluffy_Pillow 10373.3/65394: 16% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.513 aoe p arcane_explosion Fluffy_Pillow 12025.1/65394: 18% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.774 aoe q arcane_barrage Fluffy_Pillow 11174.4/65394: 17% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.036 aoe o arcane_orb Fluffy_Pillow 15440.7/65394: 24% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:22.297 shared_cds s use_mana_gem disciplinary_command 16839.9/65394: 26% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.372 aoe q arcane_barrage Fluffy_Pillow 23477.4/65394: 36% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.634 aoe p arcane_explosion Fluffy_Pillow 27743.8/65394: 42% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.897 aoe p arcane_explosion Fluffy_Pillow 26895.6/65394: 41% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:26.158 aoe p arcane_explosion Fluffy_Pillow 26044.9/65394: 40% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:27.420 aoe p arcane_explosion Fluffy_Pillow 25195.4/65394: 39% mana arcane_charge(3), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
2:28.682 aoe q arcane_barrage Fluffy_Pillow 26846.0/65394: 41% mana arcane_charge(4), crimson_chorus(3)
2:29.944 aoe p arcane_explosion Fluffy_Pillow 31112.3/65394: 48% mana crimson_chorus(3)
2:31.205 aoe p arcane_explosion Fluffy_Pillow 27761.5/65394: 42% mana arcane_charge, crimson_chorus(3)
2:32.466 aoe p arcane_explosion Fluffy_Pillow 24410.8/65394: 37% mana arcane_charge(2)
2:33.728 aoe p arcane_explosion Fluffy_Pillow 21061.3/65394: 32% mana arcane_charge(3), clearcasting
2:34.987 aoe q arcane_barrage Fluffy_Pillow 22708.0/65394: 35% mana arcane_charge(4)
2:36.250 aoe p arcane_explosion Fluffy_Pillow 26975.6/65394: 41% mana
2:37.512 aoe p arcane_explosion Fluffy_Pillow 23626.2/65394: 36% mana arcane_charge, clearcasting
2:38.773 aoe p arcane_explosion Fluffy_Pillow 25275.4/65394: 39% mana arcane_charge(2)
2:40.035 aoe p arcane_explosion Fluffy_Pillow 21925.9/65394: 34% mana arcane_charge(3)
2:41.298 aoe q arcane_barrage Fluffy_Pillow 18577.8/65394: 28% mana arcane_charge(4)
2:42.559 aoe j frostbolt Fluffy_Pillow 22842.8/65394: 35% mana
2:44.240 aoe k fire_blast Fluffy_Pillow 24041.4/65394: 37% mana
2:45.501 aoe l touch_of_the_magi Fluffy_Pillow 25190.6/65394: 39% mana disciplinary_command
2:46.761 aoe n rune_of_power Fluffy_Pillow 24338.6/65394: 37% mana arcane_charge(4), disciplinary_command
2:48.022 aoe q arcane_barrage Fluffy_Pillow 25987.8/65394: 40% mana arcane_charge(4), rune_of_power, disciplinary_command
2:49.284 aoe o arcane_orb Fluffy_Pillow 30254.1/65394: 46% mana rune_of_power, disciplinary_command
2:50.546 aoe q arcane_barrage Fluffy_Pillow 31404.7/65394: 48% mana arcane_charge(4), rune_of_power, disciplinary_command
2:51.809 aoe p arcane_explosion Fluffy_Pillow 35672.3/65394: 55% mana rune_of_power, disciplinary_command
2:53.071 aoe p arcane_explosion Fluffy_Pillow 32322.9/65394: 49% mana arcane_charge, rune_of_power, disciplinary_command
2:54.331 aoe p arcane_explosion Fluffy_Pillow 28970.8/65394: 44% mana arcane_charge(2), rune_of_power, disciplinary_command
2:55.592 aoe p arcane_explosion Fluffy_Pillow 25620.0/65394: 39% mana arcane_charge(3), rune_of_power, disciplinary_command
2:56.851 aoe q arcane_barrage Fluffy_Pillow 22266.7/65394: 34% mana arcane_charge(4), rune_of_power, disciplinary_command
2:58.113 aoe p arcane_explosion Fluffy_Pillow 26533.0/65394: 41% mana rune_of_power, disciplinary_command
2:59.377 aoe p arcane_explosion Fluffy_Pillow 23186.2/65394: 35% mana arcane_charge, rune_of_power, disciplinary_command
3:00.638 aoe p arcane_explosion Fluffy_Pillow 19835.4/65394: 30% mana arcane_charge(2), disciplinary_command
3:01.901 aoe p arcane_explosion Fluffy_Pillow 16487.3/65394: 25% mana arcane_charge(3), disciplinary_command
3:03.163 aoe q arcane_barrage Fluffy_Pillow 13137.8/65394: 20% mana arcane_charge(4), disciplinary_command, crimson_chorus
3:04.424 aoe p arcane_explosion Fluffy_Pillow 17402.8/65394: 27% mana crimson_chorus
3:05.686 aoe p arcane_explosion Fluffy_Pillow 14053.4/65394: 21% mana arcane_charge, crimson_chorus
3:06.947 aoe p arcane_explosion Fluffy_Pillow 10702.6/65394: 16% mana arcane_charge(2), clearcasting, crimson_chorus
3:08.207 aoe p arcane_explosion Fluffy_Pillow 12350.6/65394: 19% mana arcane_charge(3), crimson_chorus
3:09.468 aoe q arcane_barrage Fluffy_Pillow 8999.8/65394: 14% mana arcane_charge(4), crimson_chorus
3:10.731 aoe o arcane_orb Fluffy_Pillow 13267.4/65394: 20% mana crimson_chorus
3:11.993 aoe q arcane_barrage Fluffy_Pillow 14418.0/65394: 22% mana arcane_charge(4), crimson_chorus(2)
3:13.255 aoe p arcane_explosion Fluffy_Pillow 18684.3/65394: 29% mana crimson_chorus(2)
3:14.517 aoe p arcane_explosion Fluffy_Pillow 15334.9/65394: 23% mana arcane_charge, crimson_chorus(2)
3:15.777 aoe p arcane_explosion Fluffy_Pillow 11982.8/65394: 18% mana arcane_charge(2), crimson_chorus(2)
3:17.041 aoe p arcane_explosion Fluffy_Pillow 8636.0/65394: 13% mana arcane_charge(3), crimson_chorus(2)
3:18.302 aoe q arcane_barrage Fluffy_Pillow 5285.2/65394: 8% mana arcane_charge(4), crimson_chorus(2)
3:19.564 aoe p arcane_explosion Fluffy_Pillow 9551.5/65394: 15% mana crimson_chorus(2)
3:20.826 aoe p arcane_explosion Fluffy_Pillow 6202.1/65394: 9% mana arcane_charge, clearcasting, crimson_chorus(2)
3:22.087 aoe p arcane_explosion Fluffy_Pillow 7851.3/65394: 12% mana arcane_charge(2), crimson_chorus(3)
3:23.347 aoe r evocation disciplinary_command 4499.3/65394: 7% mana arcane_charge(3), crimson_chorus(3)
3:27.542 aoe p arcane_explosion Fluffy_Pillow 60049.3/65394: 92% mana arcane_charge(3), crimson_chorus(3)
3:28.802 aoe q arcane_barrage Fluffy_Pillow 56697.3/65394: 87% mana arcane_charge(4), crimson_chorus(3)
3:30.063 aoe p arcane_explosion Fluffy_Pillow 60962.3/65394: 93% mana crimson_chorus(3)
3:31.324 aoe p arcane_explosion Fluffy_Pillow 57611.5/65394: 88% mana arcane_charge, crimson_chorus(3)
3:32.584 aoe j frostbolt Fluffy_Pillow 54259.5/65394: 83% mana arcane_charge(2)
3:34.264 aoe k fire_blast Fluffy_Pillow 55456.7/65394: 85% mana arcane_charge(2)
3:35.525 aoe l touch_of_the_magi Fluffy_Pillow 56606.0/65394: 87% mana arcane_charge(2), disciplinary_command
3:36.785 aoe n rune_of_power Fluffy_Pillow 55753.9/65394: 85% mana arcane_charge(4), disciplinary_command
3:38.047 aoe q arcane_barrage Fluffy_Pillow 57404.5/65394: 88% mana arcane_charge(4), rune_of_power, disciplinary_command
3:39.307 aoe o arcane_orb Fluffy_Pillow 61668.2/65394: 94% mana rune_of_power, disciplinary_command
3:40.569 aoe q arcane_barrage Fluffy_Pillow 62818.7/65394: 96% mana arcane_charge(4), rune_of_power, disciplinary_command
3:41.830 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power, disciplinary_command
3:43.090 aoe p arcane_explosion Fluffy_Pillow 62042.2/65394: 95% mana arcane_charge, rune_of_power, disciplinary_command
3:44.351 aoe p arcane_explosion Fluffy_Pillow 58691.5/65394: 90% mana arcane_charge(2), clearcasting, rune_of_power, disciplinary_command
3:45.613 aoe p arcane_explosion Fluffy_Pillow 60342.0/65394: 92% mana arcane_charge(3), rune_of_power, disciplinary_command
3:46.873 aoe q arcane_barrage Fluffy_Pillow 56990.0/65394: 87% mana arcane_charge(4), rune_of_power, disciplinary_command
3:48.132 aoe p arcane_explosion Fluffy_Pillow 61252.4/65394: 94% mana rune_of_power, disciplinary_command
3:49.393 aoe p arcane_explosion Fluffy_Pillow 57901.6/65394: 89% mana arcane_charge, rune_of_power, disciplinary_command
3:50.655 aoe p arcane_explosion Fluffy_Pillow 54552.1/65394: 83% mana arcane_charge(2), disciplinary_command
3:51.917 aoe p arcane_explosion Fluffy_Pillow 51202.7/65394: 78% mana arcane_charge(3), disciplinary_command
3:53.177 aoe q arcane_barrage Fluffy_Pillow 47850.6/65394: 73% mana arcane_charge(4), clearcasting, disciplinary_command
3:54.439 aoe p arcane_explosion Fluffy_Pillow 52117.0/65394: 80% mana clearcasting
3:55.700 aoe p arcane_explosion Fluffy_Pillow 53766.2/65394: 82% mana arcane_charge
3:56.961 aoe p arcane_explosion Fluffy_Pillow 50415.4/65394: 77% mana arcane_charge(2), clearcasting
3:58.223 aoe p arcane_explosion Fluffy_Pillow 52066.0/65394: 80% mana arcane_charge(3)
3:59.485 aoe q arcane_barrage Fluffy_Pillow 48716.6/65394: 74% mana arcane_charge(4)
4:00.746 aoe o arcane_orb Fluffy_Pillow 52981.6/65394: 81% mana
4:02.006 aoe q arcane_barrage Fluffy_Pillow 54129.5/65394: 83% mana arcane_charge(4)
4:03.267 aoe p arcane_explosion Fluffy_Pillow 58394.5/65394: 89% mana crimson_chorus
4:04.528 aoe p arcane_explosion Fluffy_Pillow 55043.8/65394: 84% mana arcane_charge, crimson_chorus
4:05.787 aoe p arcane_explosion Fluffy_Pillow 51690.4/65394: 79% mana arcane_charge(2), crimson_chorus
4:07.049 aoe p arcane_explosion Fluffy_Pillow 48340.9/65394: 74% mana arcane_charge(3), crimson_chorus
4:08.311 aoe q arcane_barrage Fluffy_Pillow 44991.5/65394: 69% mana arcane_charge(4), crimson_chorus
4:09.573 aoe p arcane_explosion Fluffy_Pillow 49257.8/65394: 75% mana crimson_chorus
4:10.834 aoe p arcane_explosion Fluffy_Pillow 45907.1/65394: 70% mana arcane_charge, clearcasting, crimson_chorus
4:12.096 aoe p arcane_explosion Fluffy_Pillow 47557.6/65394: 73% mana arcane_charge(2), crimson_chorus(2)
4:13.356 aoe p arcane_explosion Fluffy_Pillow 44205.5/65394: 68% mana arcane_charge(3), crimson_chorus(2)
4:14.618 aoe q arcane_barrage Fluffy_Pillow 40856.1/65394: 62% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:15.878 aoe p arcane_explosion Fluffy_Pillow 45119.8/65394: 69% mana clearcasting, crimson_chorus(2)
4:17.139 aoe p arcane_explosion Fluffy_Pillow 46769.1/65394: 72% mana arcane_charge, crimson_chorus(2)
4:18.401 aoe p arcane_explosion Fluffy_Pillow 43419.6/65394: 66% mana arcane_charge(2), crimson_chorus(2)
4:19.663 aoe p arcane_explosion Fluffy_Pillow 40070.2/65394: 61% mana arcane_charge(3), clearcasting, crimson_chorus(2)
4:20.926 aoe q arcane_barrage Fluffy_Pillow 41722.0/65394: 64% mana arcane_charge(4), crimson_chorus(2)
4:22.187 shared_cds s use_mana_gem disciplinary_command 45987.0/65394: 70% mana crimson_chorus(3)
4:22.372 aoe j frostbolt Fluffy_Pillow 52768.4/65394: 81% mana crimson_chorus(3)
4:24.053 aoe k fire_blast Fluffy_Pillow 53967.0/65394: 83% mana crimson_chorus(3)
4:25.312 aoe l touch_of_the_magi Fluffy_Pillow 55113.6/65394: 84% mana disciplinary_command, crimson_chorus(3)
4:26.572 aoe m arcane_power Fluffy_Pillow 54261.5/65394: 83% mana arcane_charge(4), clearcasting, disciplinary_command, crimson_chorus(3)
4:26.572 shared_cds t use_items Fluffy_Pillow 54261.5/65394: 83% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3)
4:26.572 shared_cds v berserking Fluffy_Pillow 54261.5/65394: 83% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:26.572 aoe q arcane_barrage Fluffy_Pillow 54261.5/65394: 83% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:27.719 aoe o arcane_orb Fluffy_Pillow 58377.5/65394: 89% mana berserking, arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:28.868 aoe q arcane_barrage Fluffy_Pillow 59630.2/65394: 91% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:30.015 aoe p arcane_explosion Fluffy_Pillow 63746.1/65394: 97% mana berserking, arcane_power, clearcasting, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:31.163 aoe p arcane_explosion Fluffy_Pillow 65247.6/65394: 100% mana berserking, arcane_charge, arcane_power, rune_of_power, disciplinary_command, crimson_chorus(3), gladiators_badge
4:32.311 aoe p arcane_explosion Fluffy_Pillow 64249.0/65394: 98% mana berserking, arcane_charge(2), arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:33.458 aoe p arcane_explosion Fluffy_Pillow 63249.2/65394: 97% mana berserking, arcane_charge(3), arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:34.604 aoe q arcane_barrage Fluffy_Pillow 62248.0/65394: 95% mana berserking, arcane_charge(4), arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:35.751 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana berserking, arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:36.898 aoe p arcane_explosion Fluffy_Pillow 64394.4/65394: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:38.047 aoe p arcane_explosion Fluffy_Pillow 63397.2/65394: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, disciplinary_command, gladiators_badge
4:39.194 aoe p arcane_explosion Fluffy_Pillow 62397.3/65394: 95% mana arcane_charge(3), arcane_power, disciplinary_command, gladiators_badge
4:40.456 aoe n rune_of_power Fluffy_Pillow 61547.9/65394: 94% mana arcane_charge(4), arcane_power, disciplinary_command, gladiators_badge
4:41.717 aoe q arcane_barrage Fluffy_Pillow 63197.1/65394: 97% mana arcane_charge(4), rune_of_power, disciplinary_command
4:42.978 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power, disciplinary_command
4:44.239 aoe p arcane_explosion Fluffy_Pillow 62043.5/65394: 95% mana arcane_charge, clearcasting, rune_of_power
4:45.502 aoe p arcane_explosion Fluffy_Pillow 63695.4/65394: 97% mana arcane_charge(2), rune_of_power
4:46.762 aoe p arcane_explosion Fluffy_Pillow 60343.3/65394: 92% mana arcane_charge(3), rune_of_power
4:48.024 aoe q arcane_barrage Fluffy_Pillow 56993.9/65394: 87% mana arcane_charge(4), clearcasting, rune_of_power
4:49.288 aoe o arcane_orb Fluffy_Pillow 61262.8/65394: 94% mana clearcasting, rune_of_power
4:50.549 aoe q arcane_barrage Fluffy_Pillow 62412.1/65394: 95% mana arcane_charge(4), clearcasting, rune_of_power
4:51.811 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana clearcasting, rune_of_power
4:53.072 aoe p arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana arcane_charge, rune_of_power
4:54.332 aoe p arcane_explosion Fluffy_Pillow 62042.2/65394: 95% mana arcane_charge(2)
4:55.594 aoe p arcane_explosion Fluffy_Pillow 58692.8/65394: 90% mana arcane_charge(3), clearcasting
4:56.856 aoe q arcane_barrage Fluffy_Pillow 60343.3/65394: 92% mana arcane_charge(4)
4:58.118 aoe p arcane_explosion Fluffy_Pillow 64609.6/65394: 99% mana
4:59.381 aoe p arcane_explosion Fluffy_Pillow 61261.5/65394: 94% mana arcane_charge
5:00.643 aoe p arcane_explosion Fluffy_Pillow 57912.1/65394: 89% mana arcane_charge(2)
5:01.906 aoe p arcane_explosion Fluffy_Pillow 54563.9/65394: 83% mana arcane_charge(3)
5:03.168 aoe q arcane_barrage Fluffy_Pillow 51214.5/65394: 78% mana arcane_charge(4)
5:04.428 aoe p arcane_explosion Fluffy_Pillow 55478.2/65394: 85% mana crimson_chorus
5:05.690 aoe p arcane_explosion Fluffy_Pillow 52128.7/65394: 80% mana arcane_charge, crimson_chorus
5:06.952 aoe p arcane_explosion Fluffy_Pillow 48779.3/65394: 75% mana arcane_charge(2), crimson_chorus
5:08.213 aoe p arcane_explosion Fluffy_Pillow 45428.5/65394: 69% mana arcane_charge(3), crimson_chorus
5:09.475 aoe q arcane_barrage Fluffy_Pillow 42079.1/65394: 64% mana arcane_charge(4), crimson_chorus
5:10.736 aoe o arcane_orb Fluffy_Pillow 46344.1/65394: 71% mana crimson_chorus
5:11.998 aoe q arcane_barrage Fluffy_Pillow 47494.6/65394: 73% mana arcane_charge(4), crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 65394 65394 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 19.24% 19.24% 635
Versatility 7.97% 7.97% 319
Mana Regen 1308 1308 0
Mastery 30.79% 30.79% 618
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Disciplinary Command }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="disciplinary_command"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6649/6650/6758/6832/1532,ilevel=235,enchant_id=6168
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=635
# gear_mastery_rating=618
# gear_versatility_rating=319
# gear_armor=369

expanded_potential : 13263 dps, 3751 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13262.7 13262.7 21.9 / 0.165% 1294.6 / 9.8% 6.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2136.8 2027.8 Mana 0.00% 51.8 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
expanded_potential 13263
Arcane Barrage 5405 40.8% 58.7 5.10sec 27459 22863 Direct 293.1 4613 9384 5499 18.6%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.69 293.06 0.00 0.00 1.2010 0.0000 1611631.13 1611631.13 0.00% 22862.93 22862.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.42% 238.61 181 298 4613.26 1989 17288 4617.07 4259 4980 1100685 1100685 0.00%
crit 18.58% 54.45 30 84 9384.19 3978 34576 9399.36 7155 12532 510946 510946 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:58.70
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [q]:0.00
Arcane Explosion 5925 44.7% 160.2 1.84sec 11034 9210 Direct 800.9 1848 3780 2207 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 160.19 800.94 0.00 0.00 1.1980 0.0000 1767506.58 1767506.58 0.00% 9209.98 9209.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 652.04 493 804 1848.01 1391 3757 1848.79 1781 1930 1204813 1204813 0.00%
crit 18.59% 148.89 97 212 3779.51 2782 7514 3781.67 3441 4253 562693 562693 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:160.21
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1124) 0.0% (8.5%) 13.6 22.65sec 24651 20450

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.59 0.00 0.00 0.00 1.2054 0.0000 0.00 0.00 0.00% 20450.19 20450.19

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.60
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1124 8.5% 67.9 22.64sec 4937 0 Direct 67.9 4123 8412 4936 18.9%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.86 67.86 0.00 0.00 0.0000 0.0000 335035.53 335035.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.05% 55.00 37 73 4123.09 2749 7425 4129.64 3633 4521 226836 226836 0.00%
crit 18.95% 12.86 3 26 8411.93 5498 14849 8426.57 5969 11678 108199 108199 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (70) 0.0% (0.5%) 14.9 1.69sec 1380 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 70 0.5% 14.9 1.69sec 1380 0 Direct 14.9 1137 2274 1380 21.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 20525.52 20525.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.64% 11.70 3 20 1137.01 1117 1184 1136.78 1117 1184 13300 13300 0.00%
crit 21.36% 3.18 0 8 2274.30 2233 2367 2207.04 0 2367 7226 7226 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 38 0.3% 20.5 14.05sec 553 0 Direct 20.5 464 928 553 19.1%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.53 20.53 0.00 0.00 0.0000 0.0000 11352.37 11352.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 16.60 7 30 464.32 453 481 464.35 453 478 7707 7707 0.00%
crit 19.13% 3.93 0 11 928.13 907 961 913.79 0 961 3645 3645 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1195 16.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1195.82 1195.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.19% 0.83 0 1 1023.69 1024 1024 851.57 0 1024 852 852 0.00%
crit 16.81% 0.17 0 1 2047.39 2047 2047 344.25 0 2047 344 344 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (15) 0.0% (0.1%) 1.0 0.00sec 4522 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 113  / 15 0.1% 93.0 1.25sec 49 38 Direct 93.0 40 82 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2644 0.0000 4522.49 4522.49 0.00% 38.46 38.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.12% 74.51 60 84 40.46 30 51 40.46 39 42 3015 3015 0.00%
crit 19.88% 18.49 9 33 81.57 59 101 81.52 69 94 1508 1508 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (683) 0.0% (5.1%) 6.3 50.81sec 32189 25518

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 0.00 0.00 0.00 1.2615 0.0000 0.00 0.00 0.00% 25517.56 25517.56

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.32
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 683 5.1% 6.3 50.67sec 32189 0 Direct 31.4 6466 0 6466 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 31.42 0.00 0.00 0.0000 0.0000 203043.24 203043.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.42 25 40 6465.55 1002 33423 6469.73 5233 8292 203043 203043 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18413.25
  • base_dd_max:18413.25
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
expanded_potential
Arcane Power 2.9 124.82sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.91
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 249.59sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.91
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 183.81sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 7.09 0.00 4.1537 0.6970 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:expanded_potential
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.19
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:expanded_potential
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:expanded_potential
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 49.06sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.2143 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.17
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 122.42sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:expanded_potential
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.4 188.5 5.0sec 1.2sec 3.7sec 74.62% 0.00% 29.1 (30.1) 0.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.8s
  • trigger_min/max:0.0s / 6.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.2s

Stack Uptimes

  • arcane_charge_1:19.54%
  • arcane_charge_2:17.13%
  • arcane_charge_3:16.55%
  • arcane_charge_4:21.39%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 124.9sec 124.9sec 14.6sec 14.27% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 129.3s
  • trigger_min/max:120.2s / 129.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:14.27%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 249.7sec 249.7sec 11.6sec 7.41% 17.87% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:248.7s / 253.5s
  • trigger_min/max:248.7s / 253.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.41%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.1 0.1 11.5sec 11.5sec 1.9sec 15.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.72%
  • clearcasting_2:0.19%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.5sec 60.5sec 28.7sec 52.09% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 64.8s
  • trigger_min/max:60.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.37%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 169.3sec 169.3sec 4.2sec 1.66% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:95.0s / 249.1s
  • trigger_min/max:95.0s / 249.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.2s

Stack Uptimes

  • evocation_1:1.66%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 124.9sec 124.9sec 14.6sec 14.27% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:120.2s / 129.3s
  • trigger_min/max:120.2s / 129.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.27%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.1 0.0 34.2sec 34.2sec 11.8sec 35.75% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 51.0s
  • trigger_min/max:15.1s / 51.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.75%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.67%
Arcane Barrage Arcane Charge 4 100.00% 98.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.88% 0.73% 4.99% 0.9s 0.0s 4.5s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation138.5705.012337.132209.177127.575349.906
Rune of Power5.0240.39820.77332.10318.51844.320
Touch of the Magi3.8240.00022.45425.13716.96642.768
Arcane Power3.6530.2409.28510.6766.29914.788
Arcane Barrage2.6830.0038.133158.688126.738193.020
Arcane Orb2.6100.0589.65535.70427.22749.352

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
expanded_potential
mana_regen Mana 478.82 380899.30 62.89% 795.50 9124.38 2.34%
Evocation Mana 54.29 59069.73 9.75% 1088.01 0.00 0.00%
Mana Gem Mana 2.75 18010.33 2.97% 6539.43 0.00 0.00%
Arcane Barrage Mana 58.70 147668.67 24.38% 2515.74 5870.53 3.82%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 64394.3 2027.84 2136.82 14980.7 32843.5 393.2 65394.3
Usage Type Count Total Avg RPE APR
expanded_potential
arcane_explosion Mana 160.2 615406.6 3841.2 3841.8 2.9
arcane_orb Mana 13.6 6093.2 448.1 448.3 55.0
touch_of_the_magi Mana 6.3 15757.5 2500.0 2498.1 12.9

Statistics & Data Analysis

Fight Length
expanded_potential Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
expanded_potential Damage Per Second
Count 1017
Mean 13262.68
Minimum 12353.42
Maximum 14434.60
Spread ( max - min ) 2081.17
Range [ ( max - min ) / 2 * 100% ] 7.85%
Standard Deviation 355.8784
5th Percentile 12717.37
95th Percentile 13844.54
( 95th Percentile - 5th Percentile ) 1127.17
Mean Distribution
Standard Deviation 11.1594
95.00% Confidence Interval ( 13240.81 - 13284.55 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2766
0.1 Scale Factor Error with Delta=300 1082
0.05 Scale Factor Error with Delta=300 4325
0.01 Scale Factor Error with Delta=300 108116
Priority Target DPS
expanded_potential Priority Target Damage Per Second
Count 1017
Mean 3751.20
Minimum 3364.69
Maximum 4313.39
Spread ( max - min ) 948.70
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 146.6024
5th Percentile 3522.17
95th Percentile 4005.40
( 95th Percentile - 5th Percentile ) 483.22
Mean Distribution
Standard Deviation 4.5971
95.00% Confidence Interval ( 3742.19 - 3760.21 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5868
0.1 Scale Factor Error with Delta=300 184
0.05 Scale Factor Error with Delta=300 734
0.01 Scale Factor Error with Delta=300 18348
DPS(e)
expanded_potential Damage Per Second (Effective)
Count 1017
Mean 13262.68
Minimum 12353.42
Maximum 14434.60
Spread ( max - min ) 2081.17
Range [ ( max - min ) / 2 * 100% ] 7.85%
Damage
expanded_potential Damage
Count 1017
Mean 3950290.19
Minimum 3088516.00
Maximum 4689935.79
Spread ( max - min ) 1601419.79
Range [ ( max - min ) / 2 * 100% ] 20.27%
DTPS
expanded_potential Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
expanded_potential Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
expanded_potential Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
expanded_potential Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
expanded_potential Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
expanded_potential Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
expanded_potentialTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
expanded_potential Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.32 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.91 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.17 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.60 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 160.21 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 58.70 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.19 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
q 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
r 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 2.91 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.91 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkstuomonnnnonnnnonnnnlonnnrnomonnnnonnnnonnnnonnnnomonnnnonnnnonjlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnksonnnnomonnnnronnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnpnonnnnonnjksuomonnnnonnnnrlonnnnomonnnnonnnnonnnnomonnnnonnnnojlo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat N am_spam Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Q flask expanded_potential 65394.3/65394: 100% mana
Pre precombat R food expanded_potential 65394.3/65394: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 65394.3/65394: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 65394.3/65394: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 64394.3/65394: 98% mana
0:01.261 aoe k arcane_power Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.261 shared_cds s use_items Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
0:01.261 shared_cds t potion Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
0:01.261 shared_cds u berserking Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.261 aoe o arcane_barrage Fluffy_Pillow 62899.5/65394: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.145 aoe m arcane_orb Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.027 aoe o arcane_barrage Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.912 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.795 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.680 aoe n arcane_explosion Fluffy_Pillow 64051.8/65394: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.563 aoe n arcane_explosion Fluffy_Pillow 62706.6/65394: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.446 aoe o arcane_barrage Fluffy_Pillow 61361.5/65394: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.330 aoe n arcane_explosion Fluffy_Pillow 65133.4/65394: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.213 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.097 aoe n arcane_explosion Fluffy_Pillow 64050.5/65394: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.978 aoe n arcane_explosion Fluffy_Pillow 62702.7/65394: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.861 aoe o arcane_barrage Fluffy_Pillow 61357.6/65394: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.743 aoe n arcane_explosion Fluffy_Pillow 65126.9/65394: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.625 aoe n arcane_explosion Fluffy_Pillow 63780.4/65394: 98% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.597 aoe n arcane_explosion Fluffy_Pillow 62551.7/65394: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.567 aoe n arcane_explosion Fluffy_Pillow 61320.4/65394: 94% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.538 aoe l rune_of_power Fluffy_Pillow 60090.3/65394: 92% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:17.511 aoe o arcane_barrage Fluffy_Pillow 61362.9/65394: 94% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.484 aoe n arcane_explosion Fluffy_Pillow 65251.2/65394: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.457 aoe n arcane_explosion Fluffy_Pillow 61523.8/65394: 94% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.427 aoe n arcane_explosion Fluffy_Pillow 57792.5/65394: 88% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.400 shared_cds r use_mana_gem expanded_potential 54065.0/65394: 83% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.400 aoe n arcane_explosion Fluffy_Pillow 60604.5/65394: 93% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.372 aoe o arcane_barrage Fluffy_Pillow 56875.7/65394: 87% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.343 aoe m arcane_orb Fluffy_Pillow 60761.5/65394: 93% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.315 aoe o arcane_barrage Fluffy_Pillow 61532.7/65394: 94% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.287 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.255 aoe n arcane_explosion Fluffy_Pillow 61660.3/65394: 94% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.227 aoe n arcane_explosion Fluffy_Pillow 57931.6/65394: 89% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(3)
0:28.197 aoe n arcane_explosion Fluffy_Pillow 59200.2/65394: 91% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:29.170 aoe o arcane_barrage Fluffy_Pillow 55472.8/65394: 85% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3)
0:30.141 aoe n arcane_explosion Fluffy_Pillow 59358.5/65394: 91% mana bloodlust, clearcasting, crimson_chorus(3)
0:31.112 aoe n arcane_explosion Fluffy_Pillow 60628.5/65394: 93% mana bloodlust, arcane_charge
0:32.084 aoe n arcane_explosion Fluffy_Pillow 56899.8/65394: 87% mana bloodlust, arcane_charge(2)
0:33.056 aoe n arcane_explosion Fluffy_Pillow 53171.0/65394: 81% mana bloodlust, arcane_charge(3)
0:34.026 aoe o arcane_barrage Fluffy_Pillow 49439.7/65394: 76% mana bloodlust, arcane_charge(4)
0:34.997 aoe n arcane_explosion Fluffy_Pillow 53325.4/65394: 82% mana bloodlust
0:35.968 aoe n arcane_explosion Fluffy_Pillow 49595.4/65394: 76% mana bloodlust, arcane_charge
0:36.939 aoe n arcane_explosion Fluffy_Pillow 45865.3/65394: 70% mana bloodlust, arcane_charge(2)
0:37.910 aoe n arcane_explosion Fluffy_Pillow 42135.3/65394: 64% mana bloodlust, arcane_charge(3)
0:38.882 aoe o arcane_barrage Fluffy_Pillow 38406.5/65394: 59% mana bloodlust, arcane_charge(4)
0:39.854 aoe n arcane_explosion Fluffy_Pillow 42293.6/65394: 65% mana bloodlust
0:40.825 aoe n arcane_explosion Fluffy_Pillow 38563.5/65394: 59% mana bloodlust, arcane_charge
0:41.797 aoe n arcane_explosion Fluffy_Pillow 34834.8/65394: 53% mana arcane_charge(2), clearcasting
0:43.058 aoe n arcane_explosion Fluffy_Pillow 36484.0/65394: 56% mana arcane_charge(3)
0:44.320 aoe o arcane_barrage Fluffy_Pillow 33134.6/65394: 51% mana arcane_charge(4)
0:45.580 aoe m arcane_orb Fluffy_Pillow 37398.3/65394: 57% mana
0:46.841 aoe o arcane_barrage Fluffy_Pillow 38547.5/65394: 59% mana arcane_charge(4)
0:48.102 aoe n arcane_explosion Fluffy_Pillow 42812.6/65394: 65% mana
0:49.362 aoe n arcane_explosion Fluffy_Pillow 39460.5/65394: 60% mana arcane_charge, clearcasting
0:50.622 aoe n arcane_explosion Fluffy_Pillow 41108.4/65394: 63% mana arcane_charge(2)
0:51.883 aoe n arcane_explosion Fluffy_Pillow 37757.7/65394: 58% mana arcane_charge(3), clearcasting
0:53.143 aoe o arcane_barrage Fluffy_Pillow 39405.6/65394: 60% mana arcane_charge(4)
0:54.402 aoe n arcane_explosion Fluffy_Pillow 43668.0/65394: 67% mana
0:55.663 aoe n arcane_explosion Fluffy_Pillow 40317.3/65394: 62% mana arcane_charge
0:56.925 aoe n arcane_explosion Fluffy_Pillow 36967.8/65394: 57% mana arcane_charge(2)
0:58.188 aoe n arcane_explosion Fluffy_Pillow 33619.7/65394: 51% mana arcane_charge(3)
0:59.448 aoe o arcane_barrage Fluffy_Pillow 30267.6/65394: 46% mana arcane_charge(4), clearcasting
1:00.710 aoe n arcane_explosion Fluffy_Pillow 34533.9/65394: 53% mana clearcasting
1:01.973 aoe j touch_of_the_magi Fluffy_Pillow 36185.8/65394: 55% mana arcane_charge, crimson_chorus
1:03.235 aoe l rune_of_power Fluffy_Pillow 35336.3/65394: 54% mana arcane_charge(4), crimson_chorus
1:04.496 aoe o arcane_barrage Fluffy_Pillow 36985.6/65394: 57% mana arcane_charge(4), rune_of_power, crimson_chorus
1:05.758 aoe m arcane_orb Fluffy_Pillow 41251.9/65394: 63% mana rune_of_power, crimson_chorus
1:07.018 aoe o arcane_barrage Fluffy_Pillow 42399.8/65394: 65% mana arcane_charge(4), rune_of_power, crimson_chorus
1:08.281 aoe n arcane_explosion Fluffy_Pillow 46667.5/65394: 71% mana rune_of_power, crimson_chorus
1:09.543 aoe n arcane_explosion Fluffy_Pillow 43318.0/65394: 66% mana arcane_charge, rune_of_power, crimson_chorus
1:10.805 aoe n arcane_explosion Fluffy_Pillow 39968.6/65394: 61% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
1:12.067 aoe n arcane_explosion Fluffy_Pillow 36619.1/65394: 56% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:13.329 aoe o arcane_barrage Fluffy_Pillow 33269.7/65394: 51% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.589 aoe n arcane_explosion Fluffy_Pillow 37533.4/65394: 57% mana rune_of_power, crimson_chorus(2)
1:15.849 aoe n arcane_explosion Fluffy_Pillow 34181.3/65394: 52% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.109 aoe n arcane_explosion Fluffy_Pillow 30829.3/65394: 47% mana arcane_charge(2), clearcasting, crimson_chorus(2)
1:18.370 aoe n arcane_explosion Fluffy_Pillow 32478.5/65394: 50% mana arcane_charge(3), crimson_chorus(2)
1:19.632 aoe o arcane_barrage Fluffy_Pillow 29129.0/65394: 45% mana arcane_charge(4), crimson_chorus(2)
1:20.893 aoe n arcane_explosion Fluffy_Pillow 33394.1/65394: 51% mana crimson_chorus(3)
1:22.153 aoe n arcane_explosion Fluffy_Pillow 30042.0/65394: 46% mana arcane_charge, crimson_chorus(3)
1:23.416 aoe n arcane_explosion Fluffy_Pillow 26693.9/65394: 41% mana arcane_charge(2), crimson_chorus(3)
1:24.678 aoe n arcane_explosion Fluffy_Pillow 23344.4/65394: 36% mana arcane_charge(3), crimson_chorus(3)
1:25.940 aoe o arcane_barrage Fluffy_Pillow 19995.0/65394: 31% mana arcane_charge(4), crimson_chorus(3)
1:27.203 aoe m arcane_orb Fluffy_Pillow 24262.6/65394: 37% mana crimson_chorus(3)
1:28.464 aoe o arcane_barrage Fluffy_Pillow 25411.8/65394: 39% mana arcane_charge(4), crimson_chorus(3)
1:29.726 aoe n arcane_explosion Fluffy_Pillow 29678.2/65394: 45% mana crimson_chorus(3)
1:30.985 aoe n arcane_explosion Fluffy_Pillow 26324.8/65394: 40% mana arcane_charge, clearcasting
1:32.247 aoe n arcane_explosion Fluffy_Pillow 27975.3/65394: 43% mana arcane_charge(2)
1:33.507 aoe n arcane_explosion Fluffy_Pillow 24623.3/65394: 38% mana arcane_charge(3)
1:34.768 aoe o arcane_barrage Fluffy_Pillow 21272.5/65394: 33% mana arcane_charge(4)
1:36.029 aoe n arcane_explosion Fluffy_Pillow 25537.5/65394: 39% mana
1:37.289 aoe n arcane_explosion Fluffy_Pillow 22185.5/65394: 34% mana arcane_charge
1:38.552 aoe n arcane_explosion Fluffy_Pillow 18837.3/65394: 29% mana arcane_charge(2), clearcasting
1:39.814 aoe n arcane_explosion Fluffy_Pillow 20487.9/65394: 31% mana arcane_charge(3)
1:41.076 aoe o arcane_barrage Fluffy_Pillow 17138.4/65394: 26% mana arcane_charge(4), clearcasting
1:42.336 aoe n arcane_explosion Fluffy_Pillow 21402.1/65394: 33% mana clearcasting
1:43.598 aoe n arcane_explosion Fluffy_Pillow 23052.7/65394: 35% mana arcane_charge
1:44.861 aoe n arcane_explosion Fluffy_Pillow 19704.6/65394: 30% mana arcane_charge(2)
1:46.122 aoe n arcane_explosion Fluffy_Pillow 16353.8/65394: 25% mana arcane_charge(3)
1:47.383 aoe o arcane_barrage Fluffy_Pillow 13003.0/65394: 20% mana arcane_charge(4), clearcasting
1:48.645 aoe j touch_of_the_magi Fluffy_Pillow 17269.4/65394: 26% mana clearcasting
1:49.908 aoe l rune_of_power Fluffy_Pillow 16421.2/65394: 25% mana arcane_charge(4), clearcasting
1:51.170 aoe o arcane_barrage Fluffy_Pillow 18071.8/65394: 28% mana arcane_charge(4), clearcasting, rune_of_power
1:52.433 aoe m arcane_orb Fluffy_Pillow 22339.4/65394: 34% mana clearcasting, rune_of_power
1:53.693 aoe o arcane_barrage Fluffy_Pillow 23487.3/65394: 36% mana arcane_charge(4), clearcasting, rune_of_power
1:54.956 aoe n arcane_explosion Fluffy_Pillow 27755.0/65394: 42% mana clearcasting, rune_of_power
1:56.217 aoe n arcane_explosion Fluffy_Pillow 29404.2/65394: 45% mana arcane_charge, rune_of_power
1:57.480 aoe n arcane_explosion Fluffy_Pillow 26056.1/65394: 40% mana arcane_charge(2), rune_of_power
1:58.743 aoe n arcane_explosion Fluffy_Pillow 22707.9/65394: 35% mana arcane_charge(3), clearcasting, rune_of_power
2:00.004 aoe o arcane_barrage Fluffy_Pillow 24357.2/65394: 37% mana arcane_charge(4), rune_of_power
2:01.265 aoe n arcane_explosion Fluffy_Pillow 28622.2/65394: 44% mana rune_of_power
2:02.526 aoe n arcane_explosion Fluffy_Pillow 25271.4/65394: 39% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus
2:03.788 aoe n arcane_explosion Fluffy_Pillow 26922.0/65394: 41% mana arcane_charge(2), crimson_chorus
2:05.050 aoe n arcane_explosion Fluffy_Pillow 23572.5/65394: 36% mana arcane_charge(3), crimson_chorus
2:06.312 aoe k arcane_power Fluffy_Pillow 20223.1/65394: 31% mana arcane_charge(4), crimson_chorus
2:06.312 shared_cds s use_items Fluffy_Pillow 20223.1/65394: 31% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:06.312 aoe o arcane_barrage Fluffy_Pillow 20223.1/65394: 31% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:07.573 aoe n arcane_explosion Fluffy_Pillow 24488.1/65394: 37% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.834 aoe n arcane_explosion Fluffy_Pillow 23637.4/65394: 36% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.097 aoe n arcane_explosion Fluffy_Pillow 22789.2/65394: 35% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.359 aoe n arcane_explosion Fluffy_Pillow 21939.8/65394: 34% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:12.621 aoe o arcane_barrage Fluffy_Pillow 21090.3/65394: 32% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.883 aoe m arcane_orb Fluffy_Pillow 25356.6/65394: 39% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.143 aoe o arcane_barrage Fluffy_Pillow 26754.6/65394: 41% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.404 aoe n arcane_explosion Fluffy_Pillow 31019.6/65394: 47% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.665 aoe n arcane_explosion Fluffy_Pillow 30168.8/65394: 46% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.927 aoe n arcane_explosion Fluffy_Pillow 29319.4/65394: 45% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
2:20.187 aoe n arcane_explosion Fluffy_Pillow 28467.3/65394: 44% mana arcane_charge(3), arcane_power, crimson_chorus(2), gladiators_badge
2:21.448 shared_cds r use_mana_gem expanded_potential 27616.6/65394: 42% mana arcane_charge(4), crimson_chorus(3)
2:21.448 aoe o arcane_barrage Fluffy_Pillow 34156.0/65394: 52% mana arcane_charge(4), crimson_chorus(3)
2:22.710 aoe n arcane_explosion Fluffy_Pillow 38422.3/65394: 59% mana crimson_chorus(3)
2:23.973 aoe n arcane_explosion Fluffy_Pillow 35074.2/65394: 54% mana arcane_charge, crimson_chorus(3)
2:25.236 aoe n arcane_explosion Fluffy_Pillow 31726.0/65394: 49% mana arcane_charge(2), crimson_chorus(3)
2:26.498 aoe n arcane_explosion Fluffy_Pillow 28376.6/65394: 43% mana arcane_charge(3), clearcasting, crimson_chorus(3)
2:27.757 aoe o arcane_barrage Fluffy_Pillow 30023.2/65394: 46% mana arcane_charge(4), crimson_chorus(3)
2:29.017 aoe n arcane_explosion Fluffy_Pillow 34286.9/65394: 52% mana crimson_chorus(3)
2:30.279 aoe n arcane_explosion Fluffy_Pillow 30937.5/65394: 47% mana arcane_charge, clearcasting, crimson_chorus(3)
2:31.541 aoe n arcane_explosion Fluffy_Pillow 32588.0/65394: 50% mana arcane_charge(2)
2:32.803 aoe n arcane_explosion Fluffy_Pillow 29238.6/65394: 45% mana arcane_charge(3)
2:34.064 aoe o arcane_barrage Fluffy_Pillow 25887.8/65394: 40% mana arcane_charge(4)
2:35.327 aoe j touch_of_the_magi Fluffy_Pillow 30155.5/65394: 46% mana
2:36.588 aoe l rune_of_power Fluffy_Pillow 29304.7/65394: 45% mana arcane_charge(4)
2:37.849 aoe o arcane_barrage Fluffy_Pillow 30953.9/65394: 47% mana arcane_charge(4), rune_of_power
2:39.110 aoe m arcane_orb Fluffy_Pillow 35219.0/65394: 54% mana rune_of_power
2:40.371 aoe o arcane_barrage Fluffy_Pillow 36368.2/65394: 56% mana arcane_charge(4), rune_of_power
2:41.633 aoe n arcane_explosion Fluffy_Pillow 40634.5/65394: 62% mana rune_of_power
2:42.895 aoe n arcane_explosion Fluffy_Pillow 37285.1/65394: 57% mana arcane_charge, rune_of_power
2:44.157 aoe n arcane_explosion Fluffy_Pillow 33935.6/65394: 52% mana arcane_charge(2), clearcasting, rune_of_power
2:45.420 aoe n arcane_explosion Fluffy_Pillow 35587.5/65394: 54% mana arcane_charge(3), rune_of_power
2:46.680 aoe o arcane_barrage Fluffy_Pillow 32235.4/65394: 49% mana arcane_charge(4), clearcasting, rune_of_power
2:47.942 aoe n arcane_explosion Fluffy_Pillow 36501.8/65394: 56% mana clearcasting, rune_of_power
2:49.206 aoe n arcane_explosion Fluffy_Pillow 38154.9/65394: 58% mana arcane_charge, rune_of_power
2:50.466 aoe n arcane_explosion Fluffy_Pillow 34802.9/65394: 53% mana arcane_charge(2), clearcasting
2:51.727 aoe n arcane_explosion Fluffy_Pillow 36452.1/65394: 56% mana arcane_charge(3)
2:52.986 aoe o arcane_barrage Fluffy_Pillow 33098.7/65394: 51% mana arcane_charge(4)
2:54.248 aoe n arcane_explosion Fluffy_Pillow 37365.0/65394: 57% mana
2:55.509 aoe n arcane_explosion Fluffy_Pillow 34014.3/65394: 52% mana arcane_charge
2:56.772 aoe n arcane_explosion Fluffy_Pillow 30666.2/65394: 47% mana arcane_charge(2)
2:58.034 aoe n arcane_explosion Fluffy_Pillow 27316.7/65394: 42% mana arcane_charge(3)
2:59.293 aoe o arcane_barrage Fluffy_Pillow 23963.3/65394: 37% mana arcane_charge(4)
3:00.554 aoe m arcane_orb Fluffy_Pillow 28228.3/65394: 43% mana
3:01.814 aoe o arcane_barrage Fluffy_Pillow 29376.3/65394: 45% mana arcane_charge(4)
3:03.075 aoe n arcane_explosion Fluffy_Pillow 33641.3/65394: 51% mana crimson_chorus
3:04.338 aoe n arcane_explosion Fluffy_Pillow 30293.2/65394: 46% mana arcane_charge, crimson_chorus
3:05.600 aoe n arcane_explosion Fluffy_Pillow 26943.7/65394: 41% mana arcane_charge(2), crimson_chorus
3:06.862 aoe n arcane_explosion Fluffy_Pillow 23594.3/65394: 36% mana arcane_charge(3), crimson_chorus
3:08.123 aoe o arcane_barrage Fluffy_Pillow 20243.5/65394: 31% mana arcane_charge(4), crimson_chorus
3:09.385 aoe n arcane_explosion Fluffy_Pillow 24509.8/65394: 37% mana crimson_chorus
3:10.646 aoe n arcane_explosion Fluffy_Pillow 21159.1/65394: 32% mana arcane_charge, crimson_chorus
3:11.907 aoe n arcane_explosion Fluffy_Pillow 17808.3/65394: 27% mana arcane_charge(2), clearcasting, crimson_chorus
3:13.168 aoe n arcane_explosion Fluffy_Pillow 19457.6/65394: 30% mana arcane_charge(3), crimson_chorus(2)
3:14.429 aoe o arcane_barrage Fluffy_Pillow 16106.8/65394: 25% mana arcane_charge(4), crimson_chorus(2)
3:15.690 aoe n arcane_explosion Fluffy_Pillow 20371.8/65394: 31% mana crimson_chorus(2)
3:16.952 aoe n arcane_explosion Fluffy_Pillow 17022.4/65394: 26% mana arcane_charge, crimson_chorus(2)
3:18.215 aoe n arcane_explosion Fluffy_Pillow 13674.2/65394: 21% mana arcane_charge(2), crimson_chorus(2)
3:19.477 aoe n arcane_explosion Fluffy_Pillow 10324.8/65394: 16% mana arcane_charge(3), clearcasting, crimson_chorus(2)
3:20.739 aoe o arcane_barrage Fluffy_Pillow 11975.3/65394: 18% mana arcane_charge(4), crimson_chorus(2)
3:22.000 aoe j touch_of_the_magi Fluffy_Pillow 16240.4/65394: 25% mana crimson_chorus(2)
3:23.262 aoe l rune_of_power Fluffy_Pillow 15390.9/65394: 24% mana arcane_charge(4), crimson_chorus(3)
3:24.523 aoe o arcane_barrage Fluffy_Pillow 17040.1/65394: 26% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:25.785 aoe m arcane_orb Fluffy_Pillow 21306.5/65394: 33% mana rune_of_power, crimson_chorus(3)
3:27.048 aoe o arcane_barrage Fluffy_Pillow 22458.3/65394: 34% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:28.310 aoe n arcane_explosion Fluffy_Pillow 26724.7/65394: 41% mana rune_of_power, crimson_chorus(3)
3:29.572 aoe n arcane_explosion Fluffy_Pillow 23375.2/65394: 36% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:30.835 aoe n arcane_explosion Fluffy_Pillow 20027.1/65394: 31% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
3:32.097 aoe n arcane_explosion Fluffy_Pillow 16677.6/65394: 26% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
3:33.358 aoe o arcane_barrage Fluffy_Pillow 13326.9/65394: 20% mana arcane_charge(4), rune_of_power
3:34.619 aoe n arcane_explosion Fluffy_Pillow 17591.9/65394: 27% mana rune_of_power
3:35.878 aoe n arcane_explosion Fluffy_Pillow 14238.5/65394: 22% mana arcane_charge, rune_of_power
3:37.141 aoe n arcane_explosion Fluffy_Pillow 10890.4/65394: 17% mana arcane_charge(2), clearcasting
3:38.403 aoe n arcane_explosion Fluffy_Pillow 12540.9/65394: 19% mana arcane_charge(3)
3:39.664 aoe o arcane_barrage Fluffy_Pillow 9190.2/65394: 14% mana arcane_charge(4)
3:40.924 aoe n arcane_explosion Fluffy_Pillow 13453.9/65394: 21% mana
3:42.185 aoe n arcane_explosion Fluffy_Pillow 10103.1/65394: 15% mana arcane_charge
3:43.448 aoe n arcane_explosion Fluffy_Pillow 6755.0/65394: 10% mana arcane_charge(2), clearcasting
3:44.712 aoe n arcane_explosion Fluffy_Pillow 8408.1/65394: 13% mana arcane_charge(3)
3:45.973 aoe o arcane_barrage Fluffy_Pillow 5057.4/65394: 8% mana arcane_charge(4)
3:47.234 aoe m arcane_orb Fluffy_Pillow 9322.4/65394: 14% mana
3:48.495 aoe o arcane_barrage Fluffy_Pillow 10471.6/65394: 16% mana arcane_charge(4)
3:49.757 aoe n arcane_explosion Fluffy_Pillow 14738.0/65394: 23% mana
3:51.018 aoe n arcane_explosion Fluffy_Pillow 11387.2/65394: 17% mana arcane_charge
3:52.280 aoe n arcane_explosion Fluffy_Pillow 8037.8/65394: 12% mana arcane_charge(2)
3:53.541 aoe p evocation expanded_potential 4687.0/65394: 7% mana arcane_charge(3)
3:57.737 aoe n arcane_explosion Fluffy_Pillow 60238.4/65394: 92% mana arcane_charge(3)
3:58.999 aoe o arcane_barrage Fluffy_Pillow 56888.9/65394: 87% mana arcane_charge(4)
4:00.261 aoe n arcane_explosion Fluffy_Pillow 61155.3/65394: 94% mana
4:01.522 aoe n arcane_explosion Fluffy_Pillow 57804.5/65394: 88% mana arcane_charge
4:02.785 aoe n arcane_explosion Fluffy_Pillow 54456.4/65394: 83% mana arcane_charge(2)
4:04.047 aoe n arcane_explosion Fluffy_Pillow 51106.9/65394: 78% mana arcane_charge(3), crimson_chorus
4:05.308 aoe o arcane_barrage Fluffy_Pillow 47756.2/65394: 73% mana arcane_charge(4), clearcasting, crimson_chorus
4:06.569 aoe n arcane_explosion Fluffy_Pillow 52021.2/65394: 80% mana clearcasting, crimson_chorus
4:07.832 aoe n arcane_explosion Fluffy_Pillow 53673.0/65394: 82% mana arcane_charge, crimson_chorus
4:09.094 aoe j touch_of_the_magi Fluffy_Pillow 50323.6/65394: 77% mana arcane_charge(2), crimson_chorus
4:10.355 aoe k arcane_power Fluffy_Pillow 49472.8/65394: 76% mana arcane_charge(4), crimson_chorus
4:10.355 shared_cds s use_items Fluffy_Pillow 49472.8/65394: 76% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
4:10.355 shared_cds u berserking Fluffy_Pillow 49472.8/65394: 76% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:10.355 aoe o arcane_barrage Fluffy_Pillow 49472.8/65394: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:11.503 aoe m arcane_orb Fluffy_Pillow 53590.1/65394: 82% mana berserking, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:12.650 aoe o arcane_barrage Fluffy_Pillow 54840.2/65394: 84% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:13.797 aoe n arcane_explosion Fluffy_Pillow 58956.1/65394: 90% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.944 aoe n arcane_explosion Fluffy_Pillow 57956.3/65394: 89% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.093 aoe n arcane_explosion Fluffy_Pillow 56959.0/65394: 87% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.242 aoe n arcane_explosion Fluffy_Pillow 55961.8/65394: 86% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.390 aoe o arcane_barrage Fluffy_Pillow 54963.2/65394: 84% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.537 aoe n arcane_explosion Fluffy_Pillow 59079.2/65394: 90% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.683 aoe n arcane_explosion Fluffy_Pillow 58078.0/65394: 89% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.829 aoe n arcane_explosion Fluffy_Pillow 57076.8/65394: 87% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.977 aoe n arcane_explosion Fluffy_Pillow 56078.3/65394: 86% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:24.238 shared_cds r use_mana_gem expanded_potential 55227.5/65394: 84% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:24.238 aoe l rune_of_power Fluffy_Pillow 61767.0/65394: 94% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:25.499 aoe o arcane_barrage Fluffy_Pillow 63416.2/65394: 97% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:26.760 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power, crimson_chorus(3)
4:28.021 aoe n arcane_explosion Fluffy_Pillow 62043.5/65394: 95% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:29.284 aoe n arcane_explosion Fluffy_Pillow 58695.4/65394: 90% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
4:30.548 aoe n arcane_explosion Fluffy_Pillow 55348.6/65394: 85% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3)
4:31.809 aoe o arcane_barrage Fluffy_Pillow 56997.8/65394: 87% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:33.072 aoe m arcane_orb Fluffy_Pillow 61265.4/65394: 94% mana rune_of_power
4:34.332 aoe o arcane_barrage Fluffy_Pillow 62413.4/65394: 95% mana arcane_charge(4), rune_of_power
4:35.593 aoe n arcane_explosion Fluffy_Pillow 65394.3/65394: 100% mana rune_of_power
4:36.856 aoe n arcane_explosion Fluffy_Pillow 62046.1/65394: 95% mana arcane_charge, rune_of_power
4:38.117 aoe n arcane_explosion Fluffy_Pillow 58695.4/65394: 90% mana arcane_charge(2)
4:39.379 aoe n arcane_explosion Fluffy_Pillow 55345.9/65394: 85% mana arcane_charge(3)
4:40.640 aoe o arcane_barrage Fluffy_Pillow 51995.2/65394: 80% mana arcane_charge(4)
4:41.904 aoe n arcane_explosion Fluffy_Pillow 56264.1/65394: 86% mana
4:43.166 aoe n arcane_explosion Fluffy_Pillow 52914.7/65394: 81% mana arcane_charge
4:44.425 aoe n arcane_explosion Fluffy_Pillow 49561.3/65394: 76% mana arcane_charge(2), clearcasting
4:45.687 aoe n arcane_explosion Fluffy_Pillow 51211.9/65394: 78% mana arcane_charge(3)
4:46.950 aoe o arcane_barrage Fluffy_Pillow 47863.7/65394: 73% mana arcane_charge(4), clearcasting
4:48.211 aoe n arcane_explosion Fluffy_Pillow 52128.7/65394: 80% mana clearcasting
4:49.473 aoe n arcane_explosion Fluffy_Pillow 53779.3/65394: 82% mana arcane_charge
4:50.733 aoe n arcane_explosion Fluffy_Pillow 50427.2/65394: 77% mana arcane_charge(2)
4:51.993 aoe n arcane_explosion Fluffy_Pillow 47075.2/65394: 72% mana arcane_charge(3), clearcasting
4:53.254 aoe o arcane_barrage Fluffy_Pillow 48724.4/65394: 75% mana arcane_charge(4)
4:54.517 aoe m arcane_orb Fluffy_Pillow 52992.0/65394: 81% mana
4:55.778 aoe o arcane_barrage Fluffy_Pillow 54141.3/65394: 83% mana arcane_charge(4)
4:57.039 aoe n arcane_explosion Fluffy_Pillow 58406.3/65394: 89% mana
4:58.301 aoe n arcane_explosion Fluffy_Pillow 55056.8/65394: 84% mana arcane_charge
4:59.561 aoe n arcane_explosion Fluffy_Pillow 51704.8/65394: 79% mana arcane_charge(2)
5:00.822 aoe n arcane_explosion Fluffy_Pillow 48354.0/65394: 74% mana arcane_charge(3)
5:02.083 aoe o arcane_barrage Fluffy_Pillow 45003.3/65394: 69% mana arcane_charge(4)
5:03.345 aoe n arcane_explosion Fluffy_Pillow 49269.6/65394: 75% mana
5:04.605 aoe n arcane_explosion Fluffy_Pillow 45917.5/65394: 70% mana arcane_charge, crimson_chorus
5:05.866 aoe n arcane_explosion Fluffy_Pillow 42566.8/65394: 65% mana arcane_charge(2), crimson_chorus
5:07.127 aoe n arcane_explosion Fluffy_Pillow 39216.0/65394: 60% mana arcane_charge(3), crimson_chorus
5:08.389 aoe o arcane_barrage Fluffy_Pillow 35866.6/65394: 55% mana arcane_charge(4), crimson_chorus
5:09.651 aoe j touch_of_the_magi Fluffy_Pillow 40132.9/65394: 61% mana crimson_chorus
5:10.913 aoe l rune_of_power Fluffy_Pillow 39283.4/65394: 60% mana arcane_charge(4), crimson_chorus
5:12.174 aoe o arcane_barrage Fluffy_Pillow 40932.7/65394: 63% mana arcane_charge(4), rune_of_power, crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 65394 65394 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 19.24% 19.24% 635
Versatility 7.97% 7.97% 319
Mana Regen 1308 1308 0
Mastery 30.79% 30.79% 618
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Expanded Potential }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="expanded_potential"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6649/6650/6758/6831/1532,ilevel=235,enchant_id=6168
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=635
# gear_mastery_rating=618
# gear_versatility_rating=319
# gear_armor=369

no_lego : 12384 dps, 3484 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12383.8 12383.8 16.9 / 0.136% 1063.5 / 8.6% 5.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
2214.2 2104.4 Mana 0.00% 53.3 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
no_lego 12384
Arcane Barrage 5014 40.5% 60.1 4.99sec 24916 21224 Direct 299.9 4259 8721 4990 16.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.05 299.88 0.00 0.00 1.1740 0.0000 1496184.41 1496184.41 0.00% 21223.68 21223.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.61% 250.74 187 312 4258.91 1841 16130 4261.10 3966 4590 1067580 1067580 0.00%
crit 16.39% 49.14 26 74 8721.45 4745 32261 8728.64 6480 11606 428604 428604 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:60.04
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [r]:0.00
Arcane Blast 0 0.0% 0.0 0.00sec 2128 2092 Direct 0.0 2128 0 2128 0.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.2610 0.0000 2.09 2.09 0.00% 2092.00 2092.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 0.00 0 1 2127.57 2128 2128 2.09 0 2128 2 2 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [q]:0.00
Arcane Explosion 5712 46.1% 165.8 1.78sec 10284 8864 Direct 829.1 1753 3594 2057 16.5%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 165.82 829.10 0.00 0.00 1.1602 0.0000 1705297.52 1705297.52 0.00% 8864.31 8864.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.47% 692.05 535 871 1752.98 1298 3531 1754.10 1665 1861 1212974 1212974 0.00%
crit 16.53% 137.05 95 199 3593.57 2597 7063 3594.43 3272 4039 492323 492323 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:165.81
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (963) 0.0% (7.8%) 13.2 23.35sec 21765 18161

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.21 0.00 0.00 0.00 1.1985 0.0000 0.00 0.00 0.00% 18160.94 18160.94

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 963 7.8% 65.9 23.35sec 4360 0 Direct 65.9 3714 7612 4360 16.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.92 65.92 0.00 0.00 0.0000 0.0000 287415.11 287415.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.41% 54.99 39 77 3714.23 2566 6979 3713.93 3150 4258 204172 204172 0.00%
crit 16.59% 10.94 2 23 7611.97 5132 13958 7609.82 5132 10717 83243 83243 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.7%) 18.6 1.35sec 1350 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.7% 18.6 1.35sec 1350 0 Direct 18.6 1136 2275 1350 18.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.62 18.62 0.00 0.00 0.0000 0.0000 25141.87 25141.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.21% 15.12 7 25 1136.26 1117 1184 1136.15 1117 1184 17181 17181 0.00%
crit 18.79% 3.50 0 9 2275.12 2233 2367 2235.70 0 2367 7961 7961 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.3% 21.3 13.31sec 543 0 Direct 21.3 464 929 543 16.8%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.28 21.28 0.00 0.00 0.0000 0.0000 11546.04 11546.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.17% 17.70 6 31 464.50 453 481 464.52 453 475 8219 8219 0.00%
crit 16.83% 3.58 0 11 929.18 907 961 911.35 0 961 3327 3327 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 938 1876 1071 14.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1069.84 1069.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.94% 0.86 0 1 937.95 938 938 806.07 0 938 806 806 0.00%
crit 14.06% 0.14 0 1 1875.90 1876 1876 263.77 0 1876 264 264 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (17) 0.0% (0.1%) 1.0 0.00sec 5145 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 129  / 17 0.1% 117.0 0.99sec 44 44 Direct 117.0 37 75 44 17.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5145.16 5145.16 0.00% 43.58 43.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.21% 96.18 82 110 37.29 27 47 37.29 36 38 3586 3586 0.00%
crit 17.79% 20.82 7 35 74.90 55 93 74.84 66 84 1559 1559 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (550) 0.0% (4.4%) 6.2 51.58sec 26384 20581

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 0.00 0.00 0.00 1.2821 0.0000 0.00 0.00 0.00% 20580.86 20580.86

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.24
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 550 4.4% 6.2 51.46sec 26384 0 Direct 31.0 5295 0 5295 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 31.02 0.00 0.00 0.0000 0.0000 164091.23 164091.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.02 25 35 5294.58 928 34447 5283.98 3793 7310 164091 164091 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13341.26
  • base_dd_max:13341.26
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
no_lego
Arcane Power 2.9 126.81sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 253.60sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [w]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.3 230.73sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.26 0.00 7.46 0.00 4.0917 0.6889 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.34sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.1952 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.10
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.03sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [v]:1.46
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 123.64sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 60.8 190.4 4.9sec 1.2sec 3.6sec 74.14% 0.00% 27.3 (27.7) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 12.1s
  • trigger_min/max:0.0s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.08%
  • arcane_charge_2:16.65%
  • arcane_charge_3:16.95%
  • arcane_charge_4:21.45%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.7sec 126.7sec 14.7sec 14.07% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.1s / 134.3s
  • trigger_min/max:121.1s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.07%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.6sec 253.6sec 11.7sec 7.24% 7.14% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.2s / 262.6s
  • trigger_min/max:250.2s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.24%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.3 0.1 11.0sec 11.0sec 1.8sec 15.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.80%
  • clearcasting_2:0.13%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.7sec 51.86% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.4s
  • trigger_min/max:60.0s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.88%
  • crimson_chorus_2:17.28%
  • crimson_chorus_3:16.70%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.3 0.0 219.9sec 219.9sec 4.1sec 1.71% 0.00% 5.0 (5.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:91.4s / 304.6s
  • trigger_min/max:91.4s / 304.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 126.7sec 126.7sec 14.7sec 14.07% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.1s / 134.3s
  • trigger_min/max:121.1s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.07%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.6sec 34.6sec 11.8sec 35.29% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 53.6s
  • trigger_min/max:13.0s / 53.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.29%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Temporal Warp 1.5 0.0 300.1sec 300.1sec 35.8sec 17.29% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 302.9s
  • trigger_min/max:300.0s / 302.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.29%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.47%
Arcane Barrage Arcane Charge 4 100.00% 98.53% 100.00%
Arcane Blast Arcane Charge 2 0.10% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.39% 0.35% 5.43% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation102.8301.417324.044205.04199.966324.044
Rune of Power5.6510.00520.50935.63418.73348.418
Touch of the Magi4.4250.00021.41428.62816.90446.889
Arcane Power4.8431.08414.28914.1352.39223.876
Arcane Barrage2.6310.0008.262159.076127.591193.436
Arcane Orb3.2480.00010.32043.12531.01864.274
Time Warp0.9040.0002.8581.3231.2964.156

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
no_lego
mana_regen Mana 482.45 391151.34 62.23% 810.76 7380.00 1.85%
Evocation Mana 57.62 63616.17 10.12% 1104.07 0.00 0.00%
Mana Gem Mana 2.78 18557.44 2.95% 6681.71 0.00 0.00%
Arcane Barrage Mana 60.05 155206.79 24.69% 2584.82 5275.31 3.29%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 65817.1 2104.38 2214.18 12593.2 34021.6 556.7 66817.1
Usage Type Count Total Avg RPE APR
no_lego
arcane_blast Mana 0.0 4.0 4125.0 4061.1 0.5
arcane_explosion Mana 165.8 635839.8 3834.8 3834.5 2.7
arcane_orb Mana 13.2 5909.0 447.5 447.5 48.6
time_warp Mana 1.5 2927.4 2000.0 1990.1 0.0
touch_of_the_magi Mana 6.2 15539.7 2500.0 2498.6 10.6

Statistics & Data Analysis

Fight Length
no_lego Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
no_lego Damage Per Second
Count 1017
Mean 12383.80
Minimum 11725.33
Maximum 13361.98
Spread ( max - min ) 1636.64
Range [ ( max - min ) / 2 * 100% ] 6.61%
Standard Deviation 275.0211
5th Percentile 11957.80
95th Percentile 12859.81
( 95th Percentile - 5th Percentile ) 902.00
Mean Distribution
Standard Deviation 8.6239
95.00% Confidence Interval ( 12366.89 - 12400.70 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1895
0.1 Scale Factor Error with Delta=300 646
0.05 Scale Factor Error with Delta=300 2583
0.01 Scale Factor Error with Delta=300 64568
Priority Target DPS
no_lego Priority Target Damage Per Second
Count 1017
Mean 3483.95
Minimum 3132.83
Maximum 4046.89
Spread ( max - min ) 914.06
Range [ ( max - min ) / 2 * 100% ] 13.12%
Standard Deviation 121.5620
5th Percentile 3298.89
95th Percentile 3685.44
( 95th Percentile - 5th Percentile ) 386.55
Mean Distribution
Standard Deviation 3.8119
95.00% Confidence Interval ( 3476.48 - 3491.42 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4677
0.1 Scale Factor Error with Delta=300 127
0.05 Scale Factor Error with Delta=300 505
0.01 Scale Factor Error with Delta=300 12615
DPS(e)
no_lego Damage Per Second (Effective)
Count 1017
Mean 12383.80
Minimum 11725.33
Maximum 13361.98
Spread ( max - min ) 1636.64
Range [ ( max - min ) / 2 * 100% ] 6.61%
Damage
no_lego Damage
Count 1017
Mean 3690748.11
Minimum 2861457.60
Maximum 4414294.42
Spread ( max - min ) 1552836.83
Range [ ( max - min ) / 2 * 100% ] 21.04%
DTPS
no_lego Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
no_lego Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
no_lego Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
no_lego Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
no_lego Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
no_lego Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
no_legoTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
no_lego Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.24 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.10 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 165.81 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 60.04 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
s 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
t 2.86 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
v 1.46 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
w 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjvktuwomonnnnonnnnonnnnlonnnsnonnnnomonnnnonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnpnomonnnnonnnnonjlomonnnnonnnnktonnnnomonnnnonnnsnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojktwomonnnnonnnnslonnnnomonnnnonnnnonnnnomvonnnnonnnp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat N am_spam Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat Q flask no_lego 66817.1/66817: 100% mana
Pre precombat R food no_lego 66817.1/66817: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 66817.1/66817: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 66817.1/66817: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 65817.1/66817: 99% mana
0:01.301 shared_cds v time_warp Fluffy_Pillow 64325.2/66817: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.301 aoe k arcane_power Fluffy_Pillow 62325.2/66817: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.301 shared_cds t use_items Fluffy_Pillow 62325.2/66817: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.301 shared_cds u potion Fluffy_Pillow 62325.2/66817: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.301 shared_cds w berserking Fluffy_Pillow 62325.2/66817: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.301 aoe o arcane_barrage Fluffy_Pillow 62325.2/66817: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.054 aoe m arcane_orb Fluffy_Pillow 66004.1/66817: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.808 aoe o arcane_barrage Fluffy_Pillow 66761.7/66817: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.562 aoe n arcane_explosion Fluffy_Pillow 66817.1/66817: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.317 aoe n arcane_explosion Fluffy_Pillow 65326.1/66817: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.070 aoe n arcane_explosion Fluffy_Pillow 63832.3/66817: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.824 aoe n arcane_explosion Fluffy_Pillow 62340.0/66817: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.577 aoe o arcane_barrage Fluffy_Pillow 60846.2/66817: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.332 aoe n arcane_explosion Fluffy_Pillow 64527.8/66817: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.085 aoe n arcane_explosion Fluffy_Pillow 63034.1/66817: 94% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.841 aoe n arcane_explosion Fluffy_Pillow 61544.4/66817: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.596 aoe n arcane_explosion Fluffy_Pillow 62553.3/66817: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.351 aoe o arcane_barrage Fluffy_Pillow 61062.3/66817: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.105 aoe n arcane_explosion Fluffy_Pillow 64742.5/66817: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.859 aoe n arcane_explosion Fluffy_Pillow 63250.2/66817: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.614 aoe n arcane_explosion Fluffy_Pillow 61759.1/66817: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.368 aoe n arcane_explosion Fluffy_Pillow 60266.7/66817: 90% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.138 aoe l rune_of_power Fluffy_Pillow 58795.7/66817: 88% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.907 aoe o arcane_barrage Fluffy_Pillow 59823.3/66817: 90% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.678 aoe n arcane_explosion Fluffy_Pillow 63526.3/66817: 95% mana bloodlust, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.449 aoe n arcane_explosion Fluffy_Pillow 64556.7/66817: 97% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.219 aoe n arcane_explosion Fluffy_Pillow 60585.6/66817: 91% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.991 shared_cds s use_mana_gem no_lego 56617.3/66817: 85% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.991 aoe n arcane_explosion Fluffy_Pillow 63299.0/66817: 95% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.762 aoe o arcane_barrage Fluffy_Pillow 59329.3/66817: 89% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.531 aoe n arcane_explosion Fluffy_Pillow 63029.7/66817: 94% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.303 aoe n arcane_explosion Fluffy_Pillow 59061.3/66817: 88% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.073 aoe n arcane_explosion Fluffy_Pillow 55090.3/66817: 82% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.845 aoe n arcane_explosion Fluffy_Pillow 51122.0/66817: 77% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.615 aoe o arcane_barrage Fluffy_Pillow 47150.9/66817: 71% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.386 aoe m arcane_orb Fluffy_Pillow 50853.9/66817: 76% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.156 aoe o arcane_barrage Fluffy_Pillow 51382.9/66817: 77% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.925 aoe n arcane_explosion Fluffy_Pillow 55083.3/66817: 82% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.696 aoe n arcane_explosion Fluffy_Pillow 51113.6/66817: 76% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.467 aoe n arcane_explosion Fluffy_Pillow 47143.9/66817: 71% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.237 aoe n arcane_explosion Fluffy_Pillow 43172.9/66817: 65% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp, crimson_chorus(3)
0:28.007 aoe o arcane_barrage Fluffy_Pillow 44201.9/66817: 66% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:28.777 aoe n arcane_explosion Fluffy_Pillow 47903.5/66817: 72% mana bloodlust, temporal_warp, crimson_chorus(3)
0:29.547 aoe n arcane_explosion Fluffy_Pillow 43932.5/66817: 66% mana bloodlust, arcane_charge, temporal_warp, crimson_chorus(3)
0:30.318 aoe n arcane_explosion Fluffy_Pillow 39962.8/66817: 60% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:31.089 aoe n arcane_explosion Fluffy_Pillow 40993.2/66817: 61% mana bloodlust, arcane_charge(3), temporal_warp
0:31.858 aoe o arcane_barrage Fluffy_Pillow 37020.8/66817: 55% mana bloodlust, arcane_charge(4), temporal_warp
0:32.626 aoe n arcane_explosion Fluffy_Pillow 40719.8/66817: 61% mana bloodlust, temporal_warp
0:33.396 aoe n arcane_explosion Fluffy_Pillow 36748.8/66817: 55% mana bloodlust, arcane_charge, temporal_warp
0:34.166 aoe n arcane_explosion Fluffy_Pillow 32777.8/66817: 49% mana bloodlust, arcane_charge(2), temporal_warp
0:34.936 aoe n arcane_explosion Fluffy_Pillow 28806.8/66817: 43% mana bloodlust, arcane_charge(3), temporal_warp
0:35.706 aoe o arcane_barrage Fluffy_Pillow 24835.7/66817: 37% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp
0:36.476 aoe n arcane_explosion Fluffy_Pillow 28537.4/66817: 43% mana bloodlust, clearcasting, temporal_warp
0:37.245 aoe n arcane_explosion Fluffy_Pillow 29565.1/66817: 44% mana bloodlust, arcane_charge, temporal_warp
0:38.016 aoe n arcane_explosion Fluffy_Pillow 25595.4/66817: 38% mana bloodlust, arcane_charge(2), temporal_warp
0:38.786 aoe n arcane_explosion Fluffy_Pillow 21624.4/66817: 32% mana bloodlust, arcane_charge(3), temporal_warp
0:39.557 aoe o arcane_barrage Fluffy_Pillow 17654.7/66817: 26% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp
0:40.329 aoe n arcane_explosion Fluffy_Pillow 21359.0/66817: 32% mana bloodlust, clearcasting, temporal_warp
0:41.100 aoe n arcane_explosion Fluffy_Pillow 22389.4/66817: 34% mana arcane_charge, temporal_warp
0:42.100 aoe n arcane_explosion Fluffy_Pillow 18725.7/66817: 28% mana arcane_charge(2)
0:43.400 aoe n arcane_explosion Fluffy_Pillow 15462.9/66817: 23% mana arcane_charge(3)
0:44.698 aoe o arcane_barrage Fluffy_Pillow 12197.5/66817: 18% mana arcane_charge(4)
0:45.998 aoe m arcane_orb Fluffy_Pillow 16607.4/66817: 25% mana
0:47.298 aoe o arcane_barrage Fluffy_Pillow 17844.7/66817: 27% mana arcane_charge(4)
0:48.598 aoe n arcane_explosion Fluffy_Pillow 22254.6/66817: 33% mana
0:49.897 aoe n arcane_explosion Fluffy_Pillow 18990.5/66817: 28% mana arcane_charge, clearcasting
0:51.196 aoe n arcane_explosion Fluffy_Pillow 20726.4/66817: 31% mana arcane_charge(2)
0:52.495 aoe n arcane_explosion Fluffy_Pillow 17462.4/66817: 26% mana arcane_charge(3)
0:53.795 aoe o arcane_barrage Fluffy_Pillow 14199.6/66817: 21% mana arcane_charge(4), clearcasting
0:55.092 aoe n arcane_explosion Fluffy_Pillow 18605.5/66817: 28% mana clearcasting
0:56.391 aoe n arcane_explosion Fluffy_Pillow 20341.4/66817: 30% mana arcane_charge
0:57.690 aoe n arcane_explosion Fluffy_Pillow 17077.3/66817: 26% mana arcane_charge(2)
0:58.988 aoe n arcane_explosion Fluffy_Pillow 13811.9/66817: 21% mana arcane_charge(3)
1:00.287 aoe o arcane_barrage Fluffy_Pillow 10547.8/66817: 16% mana arcane_charge(4)
1:01.587 aoe j touch_of_the_magi Fluffy_Pillow 14957.8/66817: 22% mana crimson_chorus
1:02.887 aoe l rune_of_power Fluffy_Pillow 14195.0/66817: 21% mana arcane_charge(4), crimson_chorus
1:04.186 aoe o arcane_barrage Fluffy_Pillow 15930.9/66817: 24% mana arcane_charge(4), rune_of_power, crimson_chorus
1:05.487 aoe n arcane_explosion Fluffy_Pillow 20342.2/66817: 30% mana rune_of_power, crimson_chorus
1:06.786 aoe n arcane_explosion Fluffy_Pillow 17078.1/66817: 26% mana arcane_charge, rune_of_power, crimson_chorus
1:08.086 aoe n arcane_explosion Fluffy_Pillow 13815.3/66817: 21% mana arcane_charge(2), rune_of_power, crimson_chorus
1:09.385 aoe n arcane_explosion Fluffy_Pillow 10551.2/66817: 16% mana arcane_charge(3), rune_of_power, crimson_chorus
1:10.684 aoe o arcane_barrage Fluffy_Pillow 7287.1/66817: 11% mana arcane_charge(4), rune_of_power, crimson_chorus
1:11.983 aoe m arcane_orb Fluffy_Pillow 11695.7/66817: 18% mana rune_of_power, crimson_chorus(2)
1:13.283 aoe o arcane_barrage Fluffy_Pillow 12933.0/66817: 19% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.583 aoe n arcane_explosion Fluffy_Pillow 17342.9/66817: 26% mana rune_of_power, crimson_chorus(2)
1:15.883 aoe n arcane_explosion Fluffy_Pillow 14080.2/66817: 21% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.184 aoe n arcane_explosion Fluffy_Pillow 10818.7/66817: 16% mana arcane_charge(2), crimson_chorus(2)
1:18.485 aoe n arcane_explosion Fluffy_Pillow 7557.3/66817: 11% mana arcane_charge(3), crimson_chorus(2)
1:19.784 aoe o arcane_barrage Fluffy_Pillow 4293.2/66817: 6% mana arcane_charge(4), crimson_chorus(2)
1:21.083 aoe n arcane_explosion Fluffy_Pillow 8701.8/66817: 13% mana crimson_chorus(3)
1:22.381 aoe n arcane_explosion Fluffy_Pillow 5436.4/66817: 8% mana arcane_charge, clearcasting, crimson_chorus(3)
1:23.681 aoe n arcane_explosion Fluffy_Pillow 7173.7/66817: 11% mana arcane_charge(2), crimson_chorus(3)
1:24.980 aoe p evocation no_lego 3909.6/66817: 6% mana arcane_charge(3), crimson_chorus(3)
1:29.302 aoe n arcane_explosion Fluffy_Pillow 60656.0/66817: 91% mana arcane_charge(3), crimson_chorus(3)
1:30.602 aoe o arcane_barrage Fluffy_Pillow 57393.3/66817: 86% mana arcane_charge(4), crimson_chorus(3)
1:31.901 aoe m arcane_orb Fluffy_Pillow 61801.8/66817: 92% mana
1:33.284 aoe o arcane_barrage Fluffy_Pillow 63150.0/66817: 95% mana arcane_charge(4)
1:34.583 aoe n arcane_explosion Fluffy_Pillow 66817.1/66817: 100% mana
1:35.884 aoe n arcane_explosion Fluffy_Pillow 63555.7/66817: 95% mana arcane_charge
1:37.183 aoe n arcane_explosion Fluffy_Pillow 60291.6/66817: 90% mana arcane_charge(2)
1:38.480 aoe n arcane_explosion Fluffy_Pillow 57024.9/66817: 85% mana arcane_charge(3), clearcasting
1:39.780 aoe o arcane_barrage Fluffy_Pillow 58762.1/66817: 88% mana arcane_charge(4)
1:41.080 aoe n arcane_explosion Fluffy_Pillow 63172.0/66817: 95% mana
1:42.381 aoe n arcane_explosion Fluffy_Pillow 59910.6/66817: 90% mana arcane_charge
1:43.679 aoe n arcane_explosion Fluffy_Pillow 56645.2/66817: 85% mana arcane_charge(2)
1:44.979 aoe n arcane_explosion Fluffy_Pillow 53382.4/66817: 80% mana arcane_charge(3)
1:46.278 aoe o arcane_barrage Fluffy_Pillow 50118.4/66817: 75% mana arcane_charge(4)
1:47.577 aoe n arcane_explosion Fluffy_Pillow 54527.0/66817: 82% mana
1:48.877 aoe j touch_of_the_magi Fluffy_Pillow 51264.2/66817: 77% mana arcane_charge
1:50.176 aoe l rune_of_power Fluffy_Pillow 50500.1/66817: 76% mana arcane_charge(4), clearcasting
1:51.474 aoe o arcane_barrage Fluffy_Pillow 52234.7/66817: 78% mana arcane_charge(4), clearcasting, rune_of_power
1:52.775 aoe m arcane_orb Fluffy_Pillow 56645.9/66817: 85% mana clearcasting, rune_of_power
1:54.074 aoe o arcane_barrage Fluffy_Pillow 57881.9/66817: 87% mana arcane_charge(4), clearcasting, rune_of_power
1:55.373 aoe n arcane_explosion Fluffy_Pillow 62290.5/66817: 93% mana clearcasting, rune_of_power
1:56.672 aoe n arcane_explosion Fluffy_Pillow 64026.4/66817: 96% mana arcane_charge, rune_of_power
1:57.970 aoe n arcane_explosion Fluffy_Pillow 60760.9/66817: 91% mana arcane_charge(2), rune_of_power
1:59.270 aoe n arcane_explosion Fluffy_Pillow 57498.2/66817: 86% mana arcane_charge(3), rune_of_power
2:00.569 aoe o arcane_barrage Fluffy_Pillow 54234.1/66817: 81% mana arcane_charge(4), rune_of_power
2:01.869 aoe n arcane_explosion Fluffy_Pillow 58644.0/66817: 88% mana rune_of_power, crimson_chorus
2:03.171 aoe n arcane_explosion Fluffy_Pillow 55383.9/66817: 83% mana arcane_charge, rune_of_power, crimson_chorus
2:04.470 aoe n arcane_explosion Fluffy_Pillow 52119.9/66817: 78% mana arcane_charge(2), crimson_chorus
2:05.769 aoe n arcane_explosion Fluffy_Pillow 48855.8/66817: 73% mana arcane_charge(3), clearcasting, crimson_chorus
2:07.070 aoe k arcane_power Fluffy_Pillow 50594.3/66817: 76% mana arcane_charge(4), crimson_chorus
2:07.070 shared_cds t use_items Fluffy_Pillow 50594.3/66817: 76% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:07.070 aoe o arcane_barrage Fluffy_Pillow 50594.3/66817: 76% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.367 aoe n arcane_explosion Fluffy_Pillow 55000.3/66817: 82% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.666 aoe n arcane_explosion Fluffy_Pillow 54236.2/66817: 81% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.966 aoe n arcane_explosion Fluffy_Pillow 53473.4/66817: 80% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.265 aoe n arcane_explosion Fluffy_Pillow 52709.3/66817: 79% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.566 aoe o arcane_barrage Fluffy_Pillow 51947.9/66817: 78% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.865 aoe m arcane_orb Fluffy_Pillow 56356.5/66817: 84% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.165 aoe o arcane_barrage Fluffy_Pillow 57843.8/66817: 87% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.466 aoe n arcane_explosion Fluffy_Pillow 62255.0/66817: 93% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.765 aoe n arcane_explosion Fluffy_Pillow 61490.9/66817: 92% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.063 aoe n arcane_explosion Fluffy_Pillow 60725.5/66817: 91% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
2:21.362 aoe n arcane_explosion Fluffy_Pillow 59961.4/66817: 90% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:22.661 aoe o arcane_barrage Fluffy_Pillow 59197.3/66817: 89% mana arcane_charge(4), crimson_chorus(3)
2:23.960 aoe n arcane_explosion Fluffy_Pillow 63605.9/66817: 95% mana crimson_chorus(3)
2:25.259 aoe n arcane_explosion Fluffy_Pillow 60341.8/66817: 90% mana arcane_charge, crimson_chorus(3)
2:26.559 aoe n arcane_explosion Fluffy_Pillow 57079.1/66817: 85% mana arcane_charge(2), crimson_chorus(3)
2:27.858 shared_cds s use_mana_gem no_lego 53815.0/66817: 81% mana arcane_charge(3), clearcasting, crimson_chorus(3)
2:27.858 aoe n arcane_explosion Fluffy_Pillow 60496.7/66817: 91% mana arcane_charge(3), clearcasting, crimson_chorus(3)
2:29.160 aoe o arcane_barrage Fluffy_Pillow 62236.6/66817: 93% mana arcane_charge(4), crimson_chorus(3)
2:30.459 aoe n arcane_explosion Fluffy_Pillow 66645.2/66817: 100% mana crimson_chorus(3)
2:31.759 aoe n arcane_explosion Fluffy_Pillow 63382.5/66817: 95% mana arcane_charge
2:33.058 aoe n arcane_explosion Fluffy_Pillow 60118.4/66817: 90% mana arcane_charge(2), clearcasting
2:34.357 aoe n arcane_explosion Fluffy_Pillow 61854.3/66817: 93% mana arcane_charge(3)
2:35.656 aoe o arcane_barrage Fluffy_Pillow 58590.2/66817: 88% mana arcane_charge(4)
2:36.955 aoe j touch_of_the_magi Fluffy_Pillow 62998.8/66817: 94% mana
2:38.257 aoe l rune_of_power Fluffy_Pillow 62238.7/66817: 93% mana arcane_charge(4)
2:39.557 aoe o arcane_barrage Fluffy_Pillow 63975.9/66817: 96% mana arcane_charge(4), rune_of_power
2:40.856 aoe m arcane_orb Fluffy_Pillow 66817.1/66817: 100% mana rune_of_power
2:42.156 aoe o arcane_barrage Fluffy_Pillow 66817.1/66817: 100% mana arcane_charge(4), rune_of_power
2:43.457 aoe n arcane_explosion Fluffy_Pillow 66817.1/66817: 100% mana rune_of_power
2:44.757 aoe n arcane_explosion Fluffy_Pillow 63554.4/66817: 95% mana arcane_charge, rune_of_power
2:46.056 aoe n arcane_explosion Fluffy_Pillow 60290.3/66817: 90% mana arcane_charge(2), rune_of_power
2:47.355 aoe n arcane_explosion Fluffy_Pillow 57026.2/66817: 85% mana arcane_charge(3), rune_of_power
2:48.654 aoe o arcane_barrage Fluffy_Pillow 53762.1/66817: 80% mana arcane_charge(4), clearcasting, rune_of_power
2:49.953 aoe n arcane_explosion Fluffy_Pillow 58170.7/66817: 87% mana clearcasting, rune_of_power
2:51.253 aoe n arcane_explosion Fluffy_Pillow 59908.0/66817: 90% mana arcane_charge, rune_of_power
2:52.554 aoe n arcane_explosion Fluffy_Pillow 56646.5/66817: 85% mana arcane_charge(2), clearcasting
2:53.853 aoe n arcane_explosion Fluffy_Pillow 58382.4/66817: 87% mana arcane_charge(3)
2:55.152 aoe o arcane_barrage Fluffy_Pillow 55118.4/66817: 82% mana arcane_charge(4)
2:56.451 aoe n arcane_explosion Fluffy_Pillow 59527.0/66817: 89% mana
2:57.750 aoe n arcane_explosion Fluffy_Pillow 56262.9/66817: 84% mana arcane_charge
2:59.049 aoe n arcane_explosion Fluffy_Pillow 52998.8/66817: 79% mana arcane_charge(2)
3:00.349 aoe n arcane_explosion Fluffy_Pillow 49736.0/66817: 74% mana arcane_charge(3), clearcasting
3:01.648 aoe o arcane_barrage Fluffy_Pillow 51471.9/66817: 77% mana arcane_charge(4)
3:02.949 aoe m arcane_orb Fluffy_Pillow 55883.2/66817: 84% mana crimson_chorus
3:04.247 aoe o arcane_barrage Fluffy_Pillow 57117.8/66817: 85% mana arcane_charge(4), crimson_chorus
3:05.546 aoe n arcane_explosion Fluffy_Pillow 61526.4/66817: 92% mana crimson_chorus
3:06.845 aoe n arcane_explosion Fluffy_Pillow 58262.3/66817: 87% mana arcane_charge, crimson_chorus
3:08.146 aoe n arcane_explosion Fluffy_Pillow 55000.9/66817: 82% mana arcane_charge(2), crimson_chorus
3:09.446 aoe n arcane_explosion Fluffy_Pillow 51738.1/66817: 77% mana arcane_charge(3), crimson_chorus
3:10.745 aoe o arcane_barrage Fluffy_Pillow 48474.0/66817: 73% mana arcane_charge(4), crimson_chorus
3:12.044 aoe n arcane_explosion Fluffy_Pillow 52882.6/66817: 79% mana crimson_chorus
3:13.344 aoe n arcane_explosion Fluffy_Pillow 49619.9/66817: 74% mana arcane_charge, crimson_chorus(2)
3:14.645 aoe n arcane_explosion Fluffy_Pillow 46358.4/66817: 69% mana arcane_charge(2), clearcasting, crimson_chorus(2)
3:15.946 aoe n arcane_explosion Fluffy_Pillow 48097.0/66817: 72% mana arcane_charge(3), crimson_chorus(2)
3:17.245 aoe o arcane_barrage Fluffy_Pillow 44832.9/66817: 67% mana arcane_charge(4), crimson_chorus(2)
3:18.545 aoe n arcane_explosion Fluffy_Pillow 49242.9/66817: 74% mana crimson_chorus(2)
3:19.843 aoe n arcane_explosion Fluffy_Pillow 45977.4/66817: 69% mana arcane_charge, crimson_chorus(2)
3:21.144 aoe n arcane_explosion Fluffy_Pillow 42716.0/66817: 64% mana arcane_charge(2), crimson_chorus(2)
3:22.444 aoe n arcane_explosion Fluffy_Pillow 39453.3/66817: 59% mana arcane_charge(3), crimson_chorus(3)
3:23.744 aoe o arcane_barrage Fluffy_Pillow 36190.5/66817: 54% mana arcane_charge(4), crimson_chorus(3)
3:25.042 aoe j touch_of_the_magi Fluffy_Pillow 40597.8/66817: 61% mana crimson_chorus(3)
3:26.341 aoe l rune_of_power Fluffy_Pillow 39833.7/66817: 60% mana arcane_charge(4), crimson_chorus(3)
3:27.640 aoe o arcane_barrage Fluffy_Pillow 41569.6/66817: 62% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:28.939 aoe m arcane_orb Fluffy_Pillow 45978.2/66817: 69% mana rune_of_power, crimson_chorus(3)
3:30.238 aoe o arcane_barrage Fluffy_Pillow 47214.1/66817: 71% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:31.539 aoe n arcane_explosion Fluffy_Pillow 51625.4/66817: 77% mana rune_of_power, crimson_chorus(3)
3:32.838 aoe n arcane_explosion Fluffy_Pillow 48361.3/66817: 72% mana arcane_charge, rune_of_power
3:34.138 aoe n arcane_explosion Fluffy_Pillow 45098.5/66817: 67% mana arcane_charge(2), clearcasting, rune_of_power
3:35.437 aoe n arcane_explosion Fluffy_Pillow 46834.4/66817: 70% mana arcane_charge(3), rune_of_power
3:36.738 aoe o arcane_barrage Fluffy_Pillow 43573.0/66817: 65% mana arcane_charge(4), clearcasting, rune_of_power
3:38.037 aoe n arcane_explosion Fluffy_Pillow 47981.6/66817: 72% mana clearcasting, rune_of_power
3:39.337 aoe n arcane_explosion Fluffy_Pillow 49718.8/66817: 74% mana arcane_charge, rune_of_power
3:40.635 aoe n arcane_explosion Fluffy_Pillow 46453.4/66817: 70% mana arcane_charge(2)
3:41.935 aoe n arcane_explosion Fluffy_Pillow 43190.7/66817: 65% mana arcane_charge(3)
3:43.235 aoe o arcane_barrage Fluffy_Pillow 39927.9/66817: 60% mana arcane_charge(4)
3:44.533 aoe n arcane_explosion Fluffy_Pillow 44335.2/66817: 66% mana
3:45.831 aoe n arcane_explosion Fluffy_Pillow 41069.7/66817: 61% mana arcane_charge
3:47.130 aoe n arcane_explosion Fluffy_Pillow 37805.6/66817: 57% mana arcane_charge(2)
3:48.430 aoe n arcane_explosion Fluffy_Pillow 34542.9/66817: 52% mana arcane_charge(3)
3:49.728 aoe o arcane_barrage Fluffy_Pillow 31277.5/66817: 47% mana arcane_charge(4)
3:51.028 aoe m arcane_orb Fluffy_Pillow 35687.4/66817: 53% mana
3:52.326 aoe o arcane_barrage Fluffy_Pillow 36922.0/66817: 55% mana arcane_charge(4)
3:53.627 aoe n arcane_explosion Fluffy_Pillow 41333.2/66817: 62% mana
3:54.926 aoe n arcane_explosion Fluffy_Pillow 38069.1/66817: 57% mana arcane_charge, clearcasting
3:56.226 aoe n arcane_explosion Fluffy_Pillow 39806.4/66817: 60% mana arcane_charge(2)
3:57.526 aoe n arcane_explosion Fluffy_Pillow 36543.6/66817: 55% mana arcane_charge(3)
3:58.824 aoe o arcane_barrage Fluffy_Pillow 33278.2/66817: 50% mana arcane_charge(4)
4:00.123 aoe n arcane_explosion Fluffy_Pillow 37686.8/66817: 56% mana
4:01.422 aoe n arcane_explosion Fluffy_Pillow 34422.7/66817: 52% mana arcane_charge
4:02.722 aoe n arcane_explosion Fluffy_Pillow 31160.0/66817: 47% mana arcane_charge(2)
4:04.021 aoe n arcane_explosion Fluffy_Pillow 27895.9/66817: 42% mana arcane_charge(3), crimson_chorus
4:05.321 aoe o arcane_barrage Fluffy_Pillow 24633.1/66817: 37% mana arcane_charge(4), crimson_chorus
4:06.620 aoe n arcane_explosion Fluffy_Pillow 29041.7/66817: 43% mana crimson_chorus
4:07.919 aoe n arcane_explosion Fluffy_Pillow 25777.6/66817: 39% mana arcane_charge, crimson_chorus
4:09.220 aoe n arcane_explosion Fluffy_Pillow 22516.2/66817: 34% mana arcane_charge(2), crimson_chorus
4:10.519 aoe n arcane_explosion Fluffy_Pillow 19252.1/66817: 29% mana arcane_charge(3), crimson_chorus
4:11.819 aoe o arcane_barrage Fluffy_Pillow 15989.4/66817: 24% mana arcane_charge(4), clearcasting, crimson_chorus
4:13.119 aoe j touch_of_the_magi Fluffy_Pillow 20399.3/66817: 31% mana clearcasting, crimson_chorus(2)
4:14.418 aoe k arcane_power Fluffy_Pillow 19635.2/66817: 29% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:14.418 shared_cds t use_items Fluffy_Pillow 19635.2/66817: 29% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2)
4:14.418 shared_cds w berserking Fluffy_Pillow 19635.2/66817: 29% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.418 aoe o arcane_barrage Fluffy_Pillow 19635.2/66817: 29% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:15.600 aoe m arcane_orb Fluffy_Pillow 23887.4/66817: 36% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.783 aoe o arcane_barrage Fluffy_Pillow 25218.3/66817: 38% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.965 aoe n arcane_explosion Fluffy_Pillow 29470.6/66817: 44% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.148 aoe n arcane_explosion Fluffy_Pillow 31051.5/66817: 46% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.331 aoe n arcane_explosion Fluffy_Pillow 30132.4/66817: 45% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.513 aoe n arcane_explosion Fluffy_Pillow 29211.9/66817: 44% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.694 aoe o arcane_barrage Fluffy_Pillow 28290.1/66817: 42% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.876 aoe n arcane_explosion Fluffy_Pillow 32542.4/66817: 49% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.057 aoe n arcane_explosion Fluffy_Pillow 31620.6/66817: 47% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.240 aoe n arcane_explosion Fluffy_Pillow 30701.5/66817: 46% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.424 aoe n arcane_explosion Fluffy_Pillow 29783.7/66817: 45% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:28.725 shared_cds s use_mana_gem no_lego 29022.3/66817: 43% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:28.725 aoe l rune_of_power Fluffy_Pillow 35704.0/66817: 53% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:30.024 aoe o arcane_barrage Fluffy_Pillow 37439.9/66817: 56% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:31.325 aoe n arcane_explosion Fluffy_Pillow 41851.2/66817: 63% mana rune_of_power, crimson_chorus(3)
4:32.626 aoe n arcane_explosion Fluffy_Pillow 38589.8/66817: 58% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:33.926 aoe n arcane_explosion Fluffy_Pillow 35327.0/66817: 53% mana arcane_charge(2), rune_of_power
4:35.226 aoe n arcane_explosion Fluffy_Pillow 32064.3/66817: 48% mana arcane_charge(3), rune_of_power
4:36.525 aoe o arcane_barrage Fluffy_Pillow 28800.2/66817: 43% mana arcane_charge(4), rune_of_power
4:37.824 aoe m arcane_orb Fluffy_Pillow 33208.8/66817: 50% mana rune_of_power
4:39.125 aoe o arcane_barrage Fluffy_Pillow 34447.4/66817: 52% mana arcane_charge(4), rune_of_power
4:40.422 aoe n arcane_explosion Fluffy_Pillow 38853.3/66817: 58% mana rune_of_power
4:41.723 aoe n arcane_explosion Fluffy_Pillow 35591.9/66817: 53% mana arcane_charge, rune_of_power
4:43.024 aoe n arcane_explosion Fluffy_Pillow 32330.4/66817: 48% mana arcane_charge(2)
4:44.323 aoe n arcane_explosion Fluffy_Pillow 29066.4/66817: 44% mana arcane_charge(3)
4:45.623 aoe o arcane_barrage Fluffy_Pillow 25803.6/66817: 39% mana arcane_charge(4)
4:46.923 aoe n arcane_explosion Fluffy_Pillow 30213.5/66817: 45% mana
4:48.223 aoe n arcane_explosion Fluffy_Pillow 26950.8/66817: 40% mana arcane_charge
4:49.524 aoe n arcane_explosion Fluffy_Pillow 23689.4/66817: 35% mana arcane_charge(2), clearcasting
4:50.824 aoe n arcane_explosion Fluffy_Pillow 25426.6/66817: 38% mana arcane_charge(3)
4:52.123 aoe o arcane_barrage Fluffy_Pillow 22162.5/66817: 33% mana arcane_charge(4)
4:53.423 aoe n arcane_explosion Fluffy_Pillow 26572.4/66817: 40% mana
4:54.723 aoe n arcane_explosion Fluffy_Pillow 23309.7/66817: 35% mana arcane_charge
4:56.022 aoe n arcane_explosion Fluffy_Pillow 20045.6/66817: 30% mana arcane_charge(2)
4:57.322 aoe n arcane_explosion Fluffy_Pillow 16782.9/66817: 25% mana arcane_charge(3)
4:58.621 aoe o arcane_barrage Fluffy_Pillow 13518.8/66817: 20% mana arcane_charge(4)
4:59.921 aoe m arcane_orb Fluffy_Pillow 17928.7/66817: 27% mana
5:01.221 shared_cds v time_warp Fluffy_Pillow 19165.9/66817: 29% mana arcane_charge(4)
5:01.301 aoe o arcane_barrage Fluffy_Pillow 17272.8/66817: 26% mana arcane_charge(4), temporal_warp
5:02.301 aoe n arcane_explosion Fluffy_Pillow 21281.9/66817: 32% mana temporal_warp
5:03.301 aoe n arcane_explosion Fluffy_Pillow 17618.2/66817: 26% mana arcane_charge, temporal_warp
5:04.301 aoe n arcane_explosion Fluffy_Pillow 13954.6/66817: 21% mana arcane_charge(2), temporal_warp, crimson_chorus
5:05.301 aoe n arcane_explosion Fluffy_Pillow 10290.9/66817: 15% mana arcane_charge(3), temporal_warp, crimson_chorus
5:06.300 aoe o arcane_barrage Fluffy_Pillow 6625.9/66817: 10% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
5:07.301 aoe n arcane_explosion Fluffy_Pillow 10636.3/66817: 16% mana clearcasting, temporal_warp, crimson_chorus
5:08.302 aoe n arcane_explosion Fluffy_Pillow 11974.0/66817: 18% mana arcane_charge, temporal_warp, crimson_chorus
5:09.303 aoe n arcane_explosion Fluffy_Pillow 8311.6/66817: 12% mana arcane_charge(2), temporal_warp, crimson_chorus
5:10.303 aoe p evocation Fluffy_Pillow 4648.0/66817: 7% mana arcane_charge(3), temporal_warp, crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 1896 1806 1392
Intellect 450 -3 1619 1452 1005 (46)
Spirit 0 0 0 0 0
Health 37920 36120 0
Mana 66817 66817 0
Spell Power 1619 1452 0
Crit 13.66% 13.66% 303
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1336 1336 0
Mastery 33.63% 33.63% 701
Armor 333 333 333
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="no_lego"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.79
# gear_stamina=1392
# gear_intellect=1005
# gear_crit_rating=303
# gear_haste_rating=520
# gear_mastery_rating=701
# gear_versatility_rating=319
# gear_armor=333

temporal_warp : 13816 dps, 3884 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13815.7 13815.7 19.6 / 0.142% 1201.2 / 8.7% 6.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2219.0 2110.4 Mana 0.00% 53.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
temporal_warp 13816
Arcane Barrage 5598 40.5% 60.1 4.98sec 27777 23661 Direct 300.2 4663 9482 5565 18.7%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.13 300.18 0.00 0.00 1.1740 0.0000 1670245.57 1670245.57 0.00% 23660.89 23660.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.29% 244.01 188 304 4663.10 2601 17560 4665.53 4229 5015 1137635 1137635 0.00%
crit 18.71% 56.17 31 85 9482.14 5201 35119 9494.64 7313 12525 532611 532611 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:60.13
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 6377 46.2% 165.9 1.78sec 11476 9890 Direct 829.7 1920 3931 2295 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 165.94 829.70 0.00 0.00 1.1603 0.0000 1904246.47 1904246.47 0.00% 9890.39 9890.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.34% 674.89 531 840 1920.36 1427 3855 1921.41 1836 2024 1295724 1295724 0.00%
crit 18.66% 154.80 99 219 3931.24 2855 7710 3931.44 3517 4400 608523 608523 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:165.93
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1080) 0.0% (7.8%) 13.2 23.34sec 24369 20349

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.22 0.00 0.00 0.00 1.1976 0.0000 0.00 0.00 0.00% 20348.72 20348.72

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.22
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1080 7.8% 66.0 23.34sec 4881 0 Direct 66.0 4085 8370 4881 18.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.02 66.02 0.00 0.00 0.0000 0.0000 322242.31 322242.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.42% 53.76 36 74 4084.61 2821 7619 4085.32 3385 4746 219528 219528 0.00%
crit 18.58% 12.27 3 24 8369.50 5642 15237 8378.10 5709 11506 102714 102714 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.6%) 18.4 1.35sec 1375 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.6% 18.4 1.35sec 1375 0 Direct 18.4 1137 2276 1374 20.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 0.0000 0.0000 25358.70 25358.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.16% 14.60 6 23 1137.33 1117 1184 1137.14 1117 1181 16608 16608 0.00%
crit 20.84% 3.84 0 11 2276.36 2233 2367 2235.68 0 2367 8751 8751 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.3% 21.3 13.82sec 550 0 Direct 21.3 464 928 551 18.5%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.33 21.33 0.00 0.00 0.0000 0.0000 11743.84 11743.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.46% 17.38 5 34 464.48 453 481 464.43 453 475 8072 8072 0.00%
crit 18.54% 3.95 0 12 928.38 907 961 912.90 0 961 3672 3672 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1174 14.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1169.65 1169.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.74% 0.86 0 1 1023.69 1024 1024 877.74 0 1024 878 878 0.00%
crit 14.26% 0.14 0 1 2047.39 2047 2047 291.91 0 2047 292 292 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.1%) 1.0 0.00sec 5696 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 142  / 19 0.1% 117.0 0.99sec 49 48 Direct 117.0 41 81 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5695.65 5695.65 0.00% 48.24 48.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 93.75 79 108 40.55 30 51 40.55 39 42 3802 3802 0.00%
crit 19.87% 23.25 9 38 81.45 59 101 81.46 71 92 1894 1894 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (613) 0.0% (4.4%) 6.2 51.65sec 29412 22940

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 0.00 0.00 0.00 1.2821 0.0000 0.00 0.00 0.00% 22940.38 22940.38

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 613 4.4% 6.2 51.56sec 29412 0 Direct 31.0 5901 0 5901 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 31.00 0.00 0.00 0.0000 0.0000 182834.86 182834.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.00 25 35 5901.02 1017 34828 5893.49 4234 8131 182835 182835 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19654.84
  • base_dd_max:19654.84
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
temporal_warp
Arcane Power 2.9 127.05sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.20sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 230.66sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 7.10 0.00 4.1324 0.6931 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:temporal_warp
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.19
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:temporal_warp
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:temporal_warp
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.41sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.1949 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.09
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.05sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [t]:1.46
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 124.49sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:temporal_warp
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 60.9 190.5 4.9sec 1.2sec 3.6sec 74.10% 0.00% 27.3 (27.7) 0.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 12.1s
  • trigger_min/max:0.0s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.02%
  • arcane_charge_2:16.68%
  • arcane_charge_3:16.93%
  • arcane_charge_4:21.47%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.0sec 127.0sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.1s / 131.9s
  • trigger_min/max:121.1s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.0sec 254.0sec 11.7sec 7.22% 7.14% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.2s / 262.6s
  • trigger_min/max:250.2s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.22%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.58% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.58%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.2 0.1 11.1sec 11.1sec 1.8sec 15.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.77%
  • clearcasting_2:0.12%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.9sec 60.9sec 28.7sec 51.84% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.4s
  • trigger_min/max:60.0s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.87%
  • crimson_chorus_2:17.28%
  • crimson_chorus_3:16.69%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 225.0sec 225.0sec 4.1sec 1.64% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:96.0s / 295.3s
  • trigger_min/max:96.0s / 295.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.64%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 2.9 0.0 127.0sec 127.0sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.1s / 131.9s
  • trigger_min/max:121.1s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.05%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.49%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.26% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 53.6s
  • trigger_min/max:13.0s / 53.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.26%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 298.7sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.2s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Temporal Warp 1.5 0.0 300.1sec 300.1sec 35.8sec 17.29% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 302.8s
  • trigger_min/max:300.0s / 302.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.29%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.53% 0.35% 5.22% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.7s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.686120.173239.972
Evocation109.9176.032341.053209.498127.961341.053
Rune of Power5.7080.06520.50535.97320.29148.398
Touch of the Magi4.4830.00021.57228.95018.46246.870
Arcane Power4.9751.08911.87514.5073.08723.902
Arcane Barrage2.6260.0008.263158.946126.175194.860
Arcane Orb3.2440.00010.31943.12331.01564.248
Time Warp0.9090.0002.8481.3301.2974.147

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
temporal_warp
mana_regen Mana 479.93 394223.88 62.54% 821.42 7584.09 1.89%
Evocation Mana 55.05 60958.55 9.67% 1107.40 0.00 0.00%
Mana Gem Mana 2.77 18651.11 2.96% 6736.57 0.00 0.00%
Arcane Barrage Mana 60.13 156551.11 24.83% 2603.72 5465.71 3.37%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2110.43 2218.96 13082.2 34947.6 402.2 67365.7
Usage Type Count Total Avg RPE APR
temporal_warp
arcane_explosion Mana 165.9 637485.5 3841.9 3841.7 3.0
arcane_orb Mana 13.2 5914.3 447.3 447.3 54.5
time_warp Mana 1.5 2925.5 2000.0 1990.1 0.0
touch_of_the_magi Mana 6.2 15532.4 2500.0 2498.7 11.8

Statistics & Data Analysis

Fight Length
temporal_warp Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
temporal_warp Damage Per Second
Count 1017
Mean 13815.71
Minimum 12993.79
Maximum 14829.81
Spread ( max - min ) 1836.02
Range [ ( max - min ) / 2 * 100% ] 6.64%
Standard Deviation 318.3122
5th Percentile 13339.31
95th Percentile 14361.64
( 95th Percentile - 5th Percentile ) 1022.33
Mean Distribution
Standard Deviation 9.9814
95.00% Confidence Interval ( 13796.14 - 13835.27 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2040
0.1 Scale Factor Error with Delta=300 865
0.05 Scale Factor Error with Delta=300 3460
0.01 Scale Factor Error with Delta=300 86495
Priority Target DPS
temporal_warp Priority Target Damage Per Second
Count 1017
Mean 3883.58
Minimum 3521.45
Maximum 4365.81
Spread ( max - min ) 844.36
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 145.3750
5th Percentile 3654.69
95th Percentile 4132.52
( 95th Percentile - 5th Percentile ) 477.83
Mean Distribution
Standard Deviation 4.5586
95.00% Confidence Interval ( 3874.65 - 3892.52 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5383
0.1 Scale Factor Error with Delta=300 181
0.05 Scale Factor Error with Delta=300 722
0.01 Scale Factor Error with Delta=300 18042
DPS(e)
temporal_warp Damage Per Second (Effective)
Count 1017
Mean 13815.71
Minimum 12993.79
Maximum 14829.81
Spread ( max - min ) 1836.02
Range [ ( max - min ) / 2 * 100% ] 6.64%
Damage
temporal_warp Damage
Count 1017
Mean 4117841.39
Minimum 3167663.67
Maximum 4930775.28
Spread ( max - min ) 1763111.62
Range [ ( max - min ) / 2 * 100% ] 21.41%
DTPS
temporal_warp Damage Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
temporal_warp Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
temporal_warp Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
temporal_warp Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
temporal_warp Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
temporal_warp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
temporal_warpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
temporal_warp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.09 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.22 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 165.93 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 60.13 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.19 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
r 2.86 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
t 1.46 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjtkrsuomonnnnonnnnonnnnlonnnnqonnnnomonnnnonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnpnojlomonnnnonnnnkronnnnqomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojqkruomonnnnonnnnlonnnnomonnnnonnnnonntnnomonnnnonn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask temporal_warp 67365.7/67366: 100% mana
Pre precombat R food temporal_warp 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana clearcasting
0:01.300 shared_cds t time_warp Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), clearcasting, crimson_chorus
0:01.300 aoe k arcane_power Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
0:01.300 shared_cds r use_items Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus
0:01.300 shared_cds s potion Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.300 shared_cds u berserking Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.300 aoe o arcane_barrage Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.053 aoe m arcane_orb Fluffy_Pillow 66581.6/67366: 99% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.806 aoe o arcane_barrage Fluffy_Pillow 67346.1/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.560 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.316 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.070 aoe n arcane_explosion Fluffy_Pillow 65881.6/67366: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.825 aoe n arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.580 aoe o arcane_barrage Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.334 aoe n arcane_explosion Fluffy_Pillow 66626.5/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.091 aoe n arcane_explosion Fluffy_Pillow 65146.5/67366: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.846 aoe n arcane_explosion Fluffy_Pillow 63663.7/67366: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.599 aoe n arcane_explosion Fluffy_Pillow 62178.2/67366: 92% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.354 aoe o arcane_barrage Fluffy_Pillow 60695.4/67366: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.108 aoe n arcane_explosion Fluffy_Pillow 64405.9/67366: 96% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.863 aoe n arcane_explosion Fluffy_Pillow 62923.2/67366: 93% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.617 aoe n arcane_explosion Fluffy_Pillow 61439.0/67366: 91% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.371 aoe n arcane_explosion Fluffy_Pillow 59954.9/67366: 89% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.141 aoe l rune_of_power Fluffy_Pillow 58492.3/67366: 87% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.911 aoe o arcane_barrage Fluffy_Pillow 59529.8/67366: 88% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.680 aoe n arcane_explosion Fluffy_Pillow 63260.5/67366: 94% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.451 aoe n arcane_explosion Fluffy_Pillow 61799.3/67366: 92% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.223 aoe n arcane_explosion Fluffy_Pillow 57839.4/67366: 86% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.993 aoe n arcane_explosion Fluffy_Pillow 58876.8/67366: 87% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.764 shared_cds q use_mana_gem temporal_warp 54915.6/67366: 82% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.764 aoe o arcane_barrage Fluffy_Pillow 61652.2/67366: 92% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.536 aoe n arcane_explosion Fluffy_Pillow 65386.9/67366: 97% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.307 aoe n arcane_explosion Fluffy_Pillow 61425.7/67366: 91% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.077 aoe n arcane_explosion Fluffy_Pillow 57463.1/67366: 85% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.848 aoe n arcane_explosion Fluffy_Pillow 53501.9/67366: 79% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.618 aoe o arcane_barrage Fluffy_Pillow 54539.3/67366: 81% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.388 aoe m arcane_orb Fluffy_Pillow 58271.4/67366: 87% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.159 aoe o arcane_barrage Fluffy_Pillow 58810.2/67366: 87% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.931 aoe n arcane_explosion Fluffy_Pillow 62544.9/67366: 93% mana bloodlust, clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.701 aoe n arcane_explosion Fluffy_Pillow 63582.4/67366: 94% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.471 aoe n arcane_explosion Fluffy_Pillow 59619.8/67366: 89% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.240 aoe n arcane_explosion Fluffy_Pillow 55655.9/67366: 83% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:28.012 aoe o arcane_barrage Fluffy_Pillow 51696.0/67366: 77% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:28.782 aoe n arcane_explosion Fluffy_Pillow 55428.1/67366: 82% mana bloodlust, temporal_warp, crimson_chorus(3)
0:29.553 aoe n arcane_explosion Fluffy_Pillow 51466.9/67366: 76% mana bloodlust, arcane_charge, temporal_warp, crimson_chorus(3)
0:30.323 aoe n arcane_explosion Fluffy_Pillow 47504.3/67366: 71% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:31.093 aoe n arcane_explosion Fluffy_Pillow 48541.7/67366: 72% mana bloodlust, arcane_charge(3), temporal_warp
0:31.863 aoe o arcane_barrage Fluffy_Pillow 44579.2/67366: 66% mana bloodlust, arcane_charge(4), temporal_warp
0:32.632 aoe n arcane_explosion Fluffy_Pillow 48309.9/67366: 72% mana bloodlust, temporal_warp
0:33.400 aoe n arcane_explosion Fluffy_Pillow 44344.6/67366: 66% mana bloodlust, arcane_charge, temporal_warp
0:34.170 aoe n arcane_explosion Fluffy_Pillow 40382.0/67366: 60% mana bloodlust, arcane_charge(2), temporal_warp
0:34.941 aoe n arcane_explosion Fluffy_Pillow 36420.8/67366: 54% mana bloodlust, arcane_charge(3), temporal_warp
0:35.711 aoe o arcane_barrage Fluffy_Pillow 32458.2/67366: 48% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp
0:36.482 aoe n arcane_explosion Fluffy_Pillow 36191.7/67366: 54% mana bloodlust, clearcasting, temporal_warp
0:37.252 aoe n arcane_explosion Fluffy_Pillow 37229.1/67366: 55% mana bloodlust, arcane_charge, temporal_warp
0:38.023 aoe n arcane_explosion Fluffy_Pillow 33267.9/67366: 49% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:38.794 aoe n arcane_explosion Fluffy_Pillow 34306.6/67366: 51% mana bloodlust, arcane_charge(3), temporal_warp
0:39.564 aoe o arcane_barrage Fluffy_Pillow 30344.1/67366: 45% mana bloodlust, arcane_charge(4), temporal_warp
0:40.333 aoe n arcane_explosion Fluffy_Pillow 34074.8/67366: 51% mana bloodlust, temporal_warp
0:41.103 aoe n arcane_explosion Fluffy_Pillow 30112.2/67366: 45% mana arcane_charge, clearcasting, temporal_warp
0:42.104 aoe n arcane_explosion Fluffy_Pillow 31460.9/67366: 47% mana arcane_charge(2)
0:43.403 aoe n arcane_explosion Fluffy_Pillow 28211.0/67366: 42% mana arcane_charge(3)
0:44.702 aoe o arcane_barrage Fluffy_Pillow 24961.2/67366: 37% mana arcane_charge(4)
0:46.002 aoe m arcane_orb Fluffy_Pillow 29407.3/67366: 44% mana
0:47.301 aoe o arcane_barrage Fluffy_Pillow 30657.5/67366: 46% mana arcane_charge(4)
0:48.601 aoe n arcane_explosion Fluffy_Pillow 35103.6/67366: 52% mana
0:49.901 aoe n arcane_explosion Fluffy_Pillow 31855.2/67366: 47% mana arcane_charge
0:51.200 aoe n arcane_explosion Fluffy_Pillow 28605.3/67366: 42% mana arcane_charge(2)
0:52.500 aoe n arcane_explosion Fluffy_Pillow 25356.8/67366: 38% mana arcane_charge(3)
0:53.799 aoe o arcane_barrage Fluffy_Pillow 22107.0/67366: 33% mana arcane_charge(4)
0:55.098 aoe n arcane_explosion Fluffy_Pillow 26551.8/67366: 39% mana
0:56.398 aoe n arcane_explosion Fluffy_Pillow 23303.3/67366: 35% mana arcane_charge
0:57.698 aoe n arcane_explosion Fluffy_Pillow 20054.8/67366: 30% mana arcane_charge(2)
0:58.998 aoe n arcane_explosion Fluffy_Pillow 16806.3/67366: 25% mana arcane_charge(3)
1:00.298 aoe o arcane_barrage Fluffy_Pillow 13557.8/67366: 20% mana arcane_charge(4), clearcasting
1:01.596 aoe j touch_of_the_magi Fluffy_Pillow 18001.2/67366: 27% mana clearcasting, crimson_chorus
1:02.897 aoe l rune_of_power Fluffy_Pillow 17254.1/67366: 26% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.196 aoe o arcane_barrage Fluffy_Pillow 19004.3/67366: 28% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:05.493 aoe n arcane_explosion Fluffy_Pillow 23446.4/67366: 35% mana clearcasting, rune_of_power, crimson_chorus
1:06.793 aoe n arcane_explosion Fluffy_Pillow 25197.9/67366: 37% mana arcane_charge, rune_of_power, crimson_chorus
1:08.093 aoe n arcane_explosion Fluffy_Pillow 21949.4/67366: 33% mana arcane_charge(2), rune_of_power, crimson_chorus
1:09.394 aoe n arcane_explosion Fluffy_Pillow 18702.2/67366: 28% mana arcane_charge(3), rune_of_power, crimson_chorus
1:10.695 aoe o arcane_barrage Fluffy_Pillow 15455.1/67366: 23% mana arcane_charge(4), rune_of_power, crimson_chorus
1:11.996 aoe m arcane_orb Fluffy_Pillow 19902.6/67366: 30% mana rune_of_power, crimson_chorus(2)
1:13.295 aoe o arcane_barrage Fluffy_Pillow 21152.7/67366: 31% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.594 aoe n arcane_explosion Fluffy_Pillow 25597.5/67366: 38% mana rune_of_power, crimson_chorus(2)
1:15.894 aoe n arcane_explosion Fluffy_Pillow 22349.0/67366: 33% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.194 aoe n arcane_explosion Fluffy_Pillow 19100.5/67366: 28% mana arcane_charge(2), crimson_chorus(2)
1:18.496 aoe n arcane_explosion Fluffy_Pillow 15854.7/67366: 24% mana arcane_charge(3), clearcasting, crimson_chorus(2)
1:19.797 aoe o arcane_barrage Fluffy_Pillow 17607.6/67366: 26% mana arcane_charge(4), crimson_chorus(2)
1:21.096 aoe n arcane_explosion Fluffy_Pillow 22052.4/67366: 33% mana crimson_chorus(3)
1:22.396 aoe n arcane_explosion Fluffy_Pillow 18803.9/67366: 28% mana arcane_charge, crimson_chorus(3)
1:23.696 aoe n arcane_explosion Fluffy_Pillow 15555.4/67366: 23% mana arcane_charge(2), crimson_chorus(3)
1:24.994 aoe n arcane_explosion Fluffy_Pillow 12304.2/67366: 18% mana arcane_charge(3), crimson_chorus(3)
1:26.294 aoe o arcane_barrage Fluffy_Pillow 9055.7/67366: 13% mana arcane_charge(4), clearcasting, crimson_chorus(3)
1:27.594 aoe n arcane_explosion Fluffy_Pillow 13501.9/67366: 20% mana clearcasting, crimson_chorus(3)
1:28.894 aoe n arcane_explosion Fluffy_Pillow 15253.4/67366: 23% mana arcane_charge, crimson_chorus(3)
1:30.192 aoe n arcane_explosion Fluffy_Pillow 12002.2/67366: 18% mana arcane_charge(2), crimson_chorus(3)
1:31.491 aoe n arcane_explosion Fluffy_Pillow 8752.4/67366: 13% mana arcane_charge(3), clearcasting
1:32.790 aoe o arcane_barrage Fluffy_Pillow 10502.5/67366: 16% mana arcane_charge(4)
1:34.089 aoe m arcane_orb Fluffy_Pillow 14947.3/67366: 22% mana
1:35.389 aoe o arcane_barrage Fluffy_Pillow 16198.8/67366: 24% mana arcane_charge(4)
1:36.689 aoe n arcane_explosion Fluffy_Pillow 20644.9/67366: 31% mana
1:37.989 aoe n arcane_explosion Fluffy_Pillow 17396.5/67366: 26% mana arcane_charge
1:39.287 aoe n arcane_explosion Fluffy_Pillow 14145.3/67366: 21% mana arcane_charge(2)
1:40.586 aoe n arcane_explosion Fluffy_Pillow 10895.4/67366: 16% mana arcane_charge(3)
1:41.885 aoe o arcane_barrage Fluffy_Pillow 7645.6/67366: 11% mana arcane_charge(4)
1:43.187 aoe n arcane_explosion Fluffy_Pillow 12094.4/67366: 18% mana
1:44.485 aoe n arcane_explosion Fluffy_Pillow 8843.2/67366: 13% mana arcane_charge
1:45.785 aoe n arcane_explosion Fluffy_Pillow 5594.7/67366: 8% mana arcane_charge(2)
1:47.084 aoe p evocation temporal_warp 2344.9/67366: 3% mana arcane_charge(3)
1:51.403 aoe n arcane_explosion Fluffy_Pillow 59553.2/67366: 88% mana arcane_charge(3)
1:52.702 aoe o arcane_barrage Fluffy_Pillow 56303.4/67366: 84% mana arcane_charge(4), clearcasting
1:54.001 aoe j touch_of_the_magi Fluffy_Pillow 60748.2/67366: 90% mana clearcasting
1:55.298 aoe l rune_of_power Fluffy_Pillow 59995.6/67366: 89% mana arcane_charge(4), clearcasting
1:56.599 aoe o arcane_barrage Fluffy_Pillow 61748.5/67366: 92% mana arcane_charge(4), clearcasting, rune_of_power
1:57.899 aoe m arcane_orb Fluffy_Pillow 66194.6/67366: 98% mana clearcasting, rune_of_power
1:59.199 aoe o arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge(4), clearcasting, rune_of_power
2:00.499 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana clearcasting, rune_of_power
2:01.799 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, rune_of_power
2:03.098 aoe n arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge(2), rune_of_power, crimson_chorus
2:04.398 aoe n arcane_explosion Fluffy_Pillow 60867.4/67366: 90% mana arcane_charge(3), rune_of_power, crimson_chorus
2:05.699 aoe o arcane_barrage Fluffy_Pillow 57620.2/67366: 86% mana arcane_charge(4), rune_of_power, crimson_chorus
2:06.999 aoe n arcane_explosion Fluffy_Pillow 62066.4/67366: 92% mana rune_of_power, crimson_chorus
2:08.299 aoe n arcane_explosion Fluffy_Pillow 58817.9/67366: 87% mana arcane_charge, rune_of_power, crimson_chorus
2:09.598 aoe n arcane_explosion Fluffy_Pillow 55568.0/67366: 82% mana arcane_charge(2), crimson_chorus
2:10.898 aoe n arcane_explosion Fluffy_Pillow 52319.6/67366: 78% mana arcane_charge(3), crimson_chorus
2:12.198 aoe k arcane_power Fluffy_Pillow 49071.1/67366: 73% mana arcane_charge(4), crimson_chorus(2)
2:12.198 shared_cds r use_items Fluffy_Pillow 49071.1/67366: 73% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
2:12.198 aoe o arcane_barrage Fluffy_Pillow 49071.1/67366: 73% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.497 aoe n arcane_explosion Fluffy_Pillow 53515.9/67366: 79% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.799 aoe n arcane_explosion Fluffy_Pillow 52770.1/67366: 78% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.098 aoe n arcane_explosion Fluffy_Pillow 52020.2/67366: 77% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.396 aoe n arcane_explosion Fluffy_Pillow 51269.0/67366: 76% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.695 shared_cds q use_mana_gem temporal_warp 53019.2/67366: 79% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.764 aoe o arcane_barrage Fluffy_Pillow 59848.7/67366: 89% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.062 aoe m arcane_orb Fluffy_Pillow 64292.2/67366: 95% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.362 aoe o arcane_barrage Fluffy_Pillow 65793.7/67366: 98% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:22.662 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.960 aoe n arcane_explosion Fluffy_Pillow 66614.5/67366: 99% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:25.261 aoe n arcane_explosion Fluffy_Pillow 65867.4/67366: 98% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:26.560 aoe n arcane_explosion Fluffy_Pillow 65117.5/67366: 97% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:27.861 aoe o arcane_barrage Fluffy_Pillow 64370.4/67366: 96% mana arcane_charge(4), crimson_chorus(3)
2:29.161 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana crimson_chorus(3)
2:30.460 aoe n arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge, crimson_chorus(3)
2:31.759 aoe n arcane_explosion Fluffy_Pillow 60866.0/67366: 90% mana arcane_charge(2), clearcasting, crimson_chorus(3)
2:33.059 aoe n arcane_explosion Fluffy_Pillow 62617.5/67366: 93% mana arcane_charge(3)
2:34.357 aoe o arcane_barrage Fluffy_Pillow 59366.4/67366: 88% mana arcane_charge(4)
2:35.656 aoe n arcane_explosion Fluffy_Pillow 63811.1/67366: 95% mana
2:36.955 aoe n arcane_explosion Fluffy_Pillow 60561.3/67366: 90% mana arcane_charge
2:38.255 aoe n arcane_explosion Fluffy_Pillow 57312.8/67366: 85% mana arcane_charge(2)
2:39.556 aoe n arcane_explosion Fluffy_Pillow 54065.7/67366: 80% mana arcane_charge(3), clearcasting
2:40.854 aoe o arcane_barrage Fluffy_Pillow 55814.5/67366: 83% mana arcane_charge(4)
2:42.154 aoe j touch_of_the_magi Fluffy_Pillow 60260.6/67366: 89% mana
2:43.455 aoe l rune_of_power Fluffy_Pillow 59513.5/67366: 88% mana arcane_charge(4)
2:44.754 aoe o arcane_barrage Fluffy_Pillow 61263.6/67366: 91% mana arcane_charge(4), rune_of_power
2:46.053 aoe m arcane_orb Fluffy_Pillow 65708.4/67366: 98% mana rune_of_power
2:47.352 aoe o arcane_barrage Fluffy_Pillow 66958.6/67366: 99% mana arcane_charge(4), rune_of_power
2:48.652 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power
2:49.951 aoe n arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge, rune_of_power
2:51.251 aoe n arcane_explosion Fluffy_Pillow 60867.4/67366: 90% mana arcane_charge(2), rune_of_power
2:52.551 aoe n arcane_explosion Fluffy_Pillow 57618.9/67366: 86% mana arcane_charge(3), rune_of_power
2:53.850 aoe o arcane_barrage Fluffy_Pillow 54369.1/67366: 81% mana arcane_charge(4), clearcasting, rune_of_power
2:55.151 aoe n arcane_explosion Fluffy_Pillow 58816.5/67366: 87% mana clearcasting, rune_of_power
2:56.449 aoe n arcane_explosion Fluffy_Pillow 60565.4/67366: 90% mana arcane_charge, rune_of_power
2:57.750 aoe n arcane_explosion Fluffy_Pillow 57318.2/67366: 85% mana arcane_charge(2), clearcasting
2:59.048 aoe n arcane_explosion Fluffy_Pillow 59067.0/67366: 88% mana arcane_charge(3)
3:00.349 aoe o arcane_barrage Fluffy_Pillow 55819.9/67366: 83% mana arcane_charge(4)
3:01.649 aoe n arcane_explosion Fluffy_Pillow 60266.0/67366: 89% mana
3:02.950 aoe n arcane_explosion Fluffy_Pillow 57018.9/67366: 85% mana arcane_charge
3:04.249 aoe n arcane_explosion Fluffy_Pillow 53769.0/67366: 80% mana arcane_charge(2), clearcasting, crimson_chorus
3:05.549 aoe n arcane_explosion Fluffy_Pillow 55520.5/67366: 82% mana arcane_charge(3), crimson_chorus
3:06.850 aoe o arcane_barrage Fluffy_Pillow 52273.4/67366: 78% mana arcane_charge(4), crimson_chorus
3:08.149 aoe m arcane_orb Fluffy_Pillow 56718.2/67366: 84% mana crimson_chorus
3:09.448 aoe o arcane_barrage Fluffy_Pillow 57968.3/67366: 86% mana arcane_charge(4), crimson_chorus
3:10.748 aoe n arcane_explosion Fluffy_Pillow 62414.5/67366: 93% mana crimson_chorus
3:12.047 aoe n arcane_explosion Fluffy_Pillow 59164.6/67366: 88% mana arcane_charge, crimson_chorus
3:13.347 aoe n arcane_explosion Fluffy_Pillow 55916.2/67366: 83% mana arcane_charge(2), crimson_chorus(2)
3:14.647 aoe n arcane_explosion Fluffy_Pillow 52667.7/67366: 78% mana arcane_charge(3), crimson_chorus(2)
3:15.948 aoe o arcane_barrage Fluffy_Pillow 49420.5/67366: 73% mana arcane_charge(4), crimson_chorus(2)
3:17.245 aoe n arcane_explosion Fluffy_Pillow 53862.6/67366: 80% mana crimson_chorus(2)
3:18.544 aoe n arcane_explosion Fluffy_Pillow 50612.8/67366: 75% mana arcane_charge, crimson_chorus(2)
3:19.842 aoe n arcane_explosion Fluffy_Pillow 47361.6/67366: 70% mana arcane_charge(2), crimson_chorus(2)
3:21.141 aoe n arcane_explosion Fluffy_Pillow 44111.8/67366: 65% mana arcane_charge(3), crimson_chorus(2)
3:22.442 aoe o arcane_barrage Fluffy_Pillow 40864.6/67366: 61% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:23.741 aoe n arcane_explosion Fluffy_Pillow 45309.4/67366: 67% mana clearcasting, crimson_chorus(3)
3:25.039 aoe n arcane_explosion Fluffy_Pillow 47058.2/67366: 70% mana arcane_charge, crimson_chorus(3)
3:26.338 aoe n arcane_explosion Fluffy_Pillow 43808.4/67366: 65% mana arcane_charge(2), crimson_chorus(3)
3:27.635 aoe n arcane_explosion Fluffy_Pillow 40555.8/67366: 60% mana arcane_charge(3), crimson_chorus(3)
3:28.933 aoe o arcane_barrage Fluffy_Pillow 37304.7/67366: 55% mana arcane_charge(4), crimson_chorus(3)
3:30.235 aoe j touch_of_the_magi Fluffy_Pillow 41753.5/67366: 62% mana crimson_chorus(3)
3:31.535 aoe l rune_of_power Fluffy_Pillow 41005.0/67366: 61% mana arcane_charge(4), crimson_chorus(3)
3:32.835 aoe o arcane_barrage Fluffy_Pillow 42756.5/67366: 63% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:34.136 aoe m arcane_orb Fluffy_Pillow 47204.0/67366: 70% mana rune_of_power
3:35.436 aoe o arcane_barrage Fluffy_Pillow 48455.5/67366: 72% mana arcane_charge(4), rune_of_power
3:36.735 aoe n arcane_explosion Fluffy_Pillow 52900.3/67366: 79% mana rune_of_power
3:38.036 aoe n arcane_explosion Fluffy_Pillow 49653.1/67366: 74% mana arcane_charge, rune_of_power
3:39.335 aoe n arcane_explosion Fluffy_Pillow 46403.3/67366: 69% mana arcane_charge(2), rune_of_power
3:40.635 aoe n arcane_explosion Fluffy_Pillow 43154.8/67366: 64% mana arcane_charge(3), rune_of_power
3:41.934 aoe o arcane_barrage Fluffy_Pillow 39905.0/67366: 59% mana arcane_charge(4), rune_of_power
3:43.235 aoe n arcane_explosion Fluffy_Pillow 44352.5/67366: 66% mana rune_of_power
3:44.534 aoe n arcane_explosion Fluffy_Pillow 41102.6/67366: 61% mana arcane_charge, rune_of_power
3:45.834 aoe n arcane_explosion Fluffy_Pillow 37854.1/67366: 56% mana arcane_charge(2)
3:47.133 aoe n arcane_explosion Fluffy_Pillow 34604.3/67366: 51% mana arcane_charge(3), clearcasting
3:48.432 aoe o arcane_barrage Fluffy_Pillow 36354.4/67366: 54% mana arcane_charge(4)
3:49.731 aoe n arcane_explosion Fluffy_Pillow 40799.2/67366: 61% mana
3:51.030 aoe n arcane_explosion Fluffy_Pillow 37549.4/67366: 56% mana arcane_charge
3:52.330 aoe n arcane_explosion Fluffy_Pillow 34300.9/67366: 51% mana arcane_charge(2)
3:53.630 aoe n arcane_explosion Fluffy_Pillow 31052.4/67366: 46% mana arcane_charge(3)
3:54.930 aoe o arcane_barrage Fluffy_Pillow 27803.9/67366: 41% mana arcane_charge(4)
3:56.229 aoe m arcane_orb Fluffy_Pillow 32248.7/67366: 48% mana
3:57.531 aoe o arcane_barrage Fluffy_Pillow 33502.9/67366: 50% mana arcane_charge(4)
3:58.829 aoe n arcane_explosion Fluffy_Pillow 37946.4/67366: 56% mana
4:00.128 aoe n arcane_explosion Fluffy_Pillow 34696.5/67366: 52% mana arcane_charge
4:01.426 aoe n arcane_explosion Fluffy_Pillow 31445.3/67366: 47% mana arcane_charge(2)
4:02.725 aoe n arcane_explosion Fluffy_Pillow 28195.5/67366: 42% mana arcane_charge(3)
4:04.025 aoe o arcane_barrage Fluffy_Pillow 24947.0/67366: 37% mana arcane_charge(4)
4:05.325 aoe n arcane_explosion Fluffy_Pillow 29393.1/67366: 44% mana crimson_chorus
4:06.623 aoe n arcane_explosion Fluffy_Pillow 26142.0/67366: 39% mana arcane_charge, crimson_chorus
4:07.923 aoe n arcane_explosion Fluffy_Pillow 22893.5/67366: 34% mana arcane_charge(2), clearcasting, crimson_chorus
4:09.223 aoe n arcane_explosion Fluffy_Pillow 24645.0/67366: 37% mana arcane_charge(3), crimson_chorus
4:10.522 aoe o arcane_barrage Fluffy_Pillow 21395.1/67366: 32% mana arcane_charge(4), clearcasting, crimson_chorus
4:11.822 aoe n arcane_explosion Fluffy_Pillow 25841.3/67366: 38% mana clearcasting, crimson_chorus
4:13.122 aoe n arcane_explosion Fluffy_Pillow 27592.8/67366: 41% mana arcane_charge, crimson_chorus
4:14.422 aoe n arcane_explosion Fluffy_Pillow 24344.3/67366: 36% mana arcane_charge(2), crimson_chorus(2)
4:15.721 aoe n arcane_explosion Fluffy_Pillow 21094.5/67366: 31% mana arcane_charge(3), crimson_chorus(2)
4:17.020 aoe o arcane_barrage Fluffy_Pillow 17844.6/67366: 26% mana arcane_charge(4), crimson_chorus(2)
4:18.319 aoe j touch_of_the_magi Fluffy_Pillow 22289.4/67366: 33% mana crimson_chorus(2)
4:19.616 shared_cds q use_mana_gem temporal_warp 21536.9/67366: 32% mana arcane_charge(4), crimson_chorus(2)
4:19.616 aoe k arcane_power Fluffy_Pillow 28273.4/67366: 42% mana arcane_charge(4), crimson_chorus(2)
4:19.616 shared_cds r use_items Fluffy_Pillow 28273.4/67366: 42% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:19.616 shared_cds u berserking Fluffy_Pillow 28273.4/67366: 42% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.616 aoe o arcane_barrage Fluffy_Pillow 28273.4/67366: 42% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.799 aoe m arcane_orb Fluffy_Pillow 32561.9/67366: 48% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.981 aoe o arcane_barrage Fluffy_Pillow 33904.5/67366: 50% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.165 aoe n arcane_explosion Fluffy_Pillow 38194.3/67366: 57% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.348 aoe n arcane_explosion Fluffy_Pillow 37288.2/67366: 55% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.531 aoe n arcane_explosion Fluffy_Pillow 36382.1/67366: 54% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.713 aoe n arcane_explosion Fluffy_Pillow 35474.6/67366: 53% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.896 aoe o arcane_barrage Fluffy_Pillow 34568.5/67366: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.079 aoe n arcane_explosion Fluffy_Pillow 38857.0/67366: 58% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.262 aoe n arcane_explosion Fluffy_Pillow 37950.8/67366: 56% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.444 aoe n arcane_explosion Fluffy_Pillow 37043.4/67366: 55% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:32.627 aoe n arcane_explosion Fluffy_Pillow 36137.2/67366: 54% mana arcane_charge(3), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
4:33.927 aoe l rune_of_power Fluffy_Pillow 37888.7/67366: 56% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:35.227 aoe o arcane_barrage Fluffy_Pillow 39640.2/67366: 59% mana arcane_charge(4), rune_of_power
4:36.528 aoe n arcane_explosion Fluffy_Pillow 44087.7/67366: 65% mana rune_of_power
4:37.826 aoe n arcane_explosion Fluffy_Pillow 40836.5/67366: 61% mana arcane_charge, clearcasting, rune_of_power
4:39.126 aoe n arcane_explosion Fluffy_Pillow 42588.1/67366: 63% mana arcane_charge(2), rune_of_power
4:40.427 aoe n arcane_explosion Fluffy_Pillow 39340.9/67366: 58% mana arcane_charge(3), rune_of_power
4:41.728 aoe o arcane_barrage Fluffy_Pillow 36093.8/67366: 54% mana arcane_charge(4), clearcasting, rune_of_power
4:43.028 aoe m arcane_orb Fluffy_Pillow 40539.9/67366: 60% mana clearcasting, rune_of_power
4:44.331 aoe o arcane_barrage Fluffy_Pillow 41795.5/67366: 62% mana arcane_charge(4), clearcasting, rune_of_power
4:45.632 aoe n arcane_explosion Fluffy_Pillow 46242.9/67366: 69% mana clearcasting, rune_of_power
4:46.931 aoe n arcane_explosion Fluffy_Pillow 47993.1/67366: 71% mana arcane_charge, rune_of_power
4:48.231 aoe n arcane_explosion Fluffy_Pillow 44744.6/67366: 66% mana arcane_charge(2), clearcasting
4:49.529 aoe n arcane_explosion Fluffy_Pillow 46493.4/67366: 69% mana arcane_charge(3)
4:50.829 aoe o arcane_barrage Fluffy_Pillow 43244.9/67366: 64% mana arcane_charge(4)
4:52.129 aoe n arcane_explosion Fluffy_Pillow 47691.1/67366: 71% mana
4:53.428 aoe n arcane_explosion Fluffy_Pillow 44441.2/67366: 66% mana arcane_charge
4:54.726 aoe n arcane_explosion Fluffy_Pillow 41190.0/67366: 61% mana arcane_charge(2)
4:56.025 aoe n arcane_explosion Fluffy_Pillow 37940.2/67366: 56% mana arcane_charge(3)
4:57.326 aoe o arcane_barrage Fluffy_Pillow 34693.1/67366: 51% mana arcane_charge(4)
4:58.625 aoe n arcane_explosion Fluffy_Pillow 39137.9/67366: 58% mana
4:59.924 aoe n arcane_explosion Fluffy_Pillow 35888.0/67366: 53% mana arcane_charge
5:01.225 shared_cds t time_warp Fluffy_Pillow 32640.9/67366: 48% mana arcane_charge(2), clearcasting
5:01.300 aoe n arcane_explosion Fluffy_Pillow 30741.9/67366: 46% mana arcane_charge(2), clearcasting, temporal_warp
5:02.301 aoe n arcane_explosion Fluffy_Pillow 32090.6/67366: 48% mana arcane_charge(3), temporal_warp
5:03.301 aoe o arcane_barrage Fluffy_Pillow 28437.9/67366: 42% mana arcane_charge(4), temporal_warp
5:04.304 aoe m arcane_orb Fluffy_Pillow 32483.9/67366: 48% mana temporal_warp
5:05.304 aoe o arcane_barrage Fluffy_Pillow 33331.2/67366: 49% mana arcane_charge(4), temporal_warp, crimson_chorus
5:06.305 aoe n arcane_explosion Fluffy_Pillow 37374.5/67366: 55% mana temporal_warp, crimson_chorus
5:07.306 aoe n arcane_explosion Fluffy_Pillow 33723.1/67366: 50% mana arcane_charge, temporal_warp, crimson_chorus
5:08.307 aoe n arcane_explosion Fluffy_Pillow 30071.8/67366: 45% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
5:09.307 aoe n arcane_explosion Fluffy_Pillow 31419.1/67366: 47% mana arcane_charge(3), temporal_warp, crimson_chorus
5:10.309 aoe o arcane_barrage Fluffy_Pillow 27769.1/67366: 41% mana arcane_charge(4), temporal_warp, crimson_chorus
5:11.310 aoe n arcane_explosion Fluffy_Pillow 31812.4/67366: 47% mana temporal_warp, crimson_chorus
5:12.309 aoe n arcane_explosion Fluffy_Pillow 28158.4/67366: 42% mana arcane_charge, temporal_warp, crimson_chorus

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="temporal_warp"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=5>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Simulation & Raid Information

Iterations: 1033
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 298.7 )

Performance:

Total Events Processed: 24718083
Max Event Queue: 230
Sim Seconds: 308543
CPU Seconds: 32.3750
Physical Seconds: 4.1011
Speed Up: 9530

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Bombardment Bombardment arcane_barrage 44425 2278524 7628 58.89 6538 13206 58.7 293.2 18.5% 0.0% 0.0% 0.0% 5.11sec 2278524 298.69sec
Bombardment Bombardment arcane_explosion 1449 1768727 5922 160.99 1847 3784 160.3 801.4 18.6% 0.0% 0.0% 0.0% 1.84sec 1768727 298.69sec
Bombardment Bombardment arcane_orb 153626 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 22.63sec 0 298.69sec
Bombardment Bombardment arcane_orb_bolt 153640 334131 1119 13.63 4128 8407 67.8 67.8 18.6% 0.0% 0.0% 0.0% 22.63sec 334131 298.69sec
Bombardment Bombardment arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 124.92sec 0 298.69sec
Bombardment Bombardment berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 249.60sec 0 298.69sec
Bombardment Bombardment conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Bombardment Bombardment deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.70sec 0 298.69sec
Bombardment Bombardment deathly_eruption 322256 20230 68 2.96 1137 2274 14.7 14.7 20.9% 0.0% 0.0% 0.0% 1.70sec 20230 298.69sec
Bombardment Bombardment eternal_insight 342314 11371 38 4.13 465 929 20.6 20.6 19.1% 0.0% 0.0% 0.0% 14.15sec 11371 298.69sec
Bombardment Bombardment evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 174.18sec 0 298.69sec
Bombardment Bombardment flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Bombardment Bombardment food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Bombardment Bombardment frostbolt 116 1201 4 0.20 1024 2047 0.0 1.0 17.3% 0.0% 0.0% 0.0% 0.00sec 1201 298.69sec
Bombardment Bombardment mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Bombardment Bombardment_mirror_image frostbolt 59638 4516 113 139.50 40 82 93.0 93.0 19.7% 0.0% 0.0% 0.0% 1.25sec 4516 40.00sec
Bombardment Bombardment potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Bombardment Bombardment rune_of_power 116011 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 49.07sec 0 298.69sec
Bombardment Bombardment touch_of_the_magi 321507 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 50.81sec 0 298.69sec
Bombardment Bombardment touch_of_the_magi_explosion 210833 256160 858 6.31 8160 0 6.3 31.4 0.0% 0.0% 0.0% 0.0% 50.68sec 256160 298.69sec
Bombardment Bombardment use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.96sec 0 298.69sec
Harmony Harmony arcane_barrage 44425 1727061 5782 50.50 5753 11746 50.4 251.4 18.6% 0.0% 0.0% 0.0% 5.96sec 1727061 298.69sec
Harmony Harmony arcane_blast 30451 4 0 0.00 1951 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 4 298.69sec
Harmony Harmony arcane_explosion 1449 1476496 4943 131.80 1882 3859 131.2 656.1 18.7% 0.0% 0.0% 0.0% 2.25sec 1476496 298.69sec
Harmony Harmony arcane_missiles ticks -5143 302142 1007 39.59 1282 2606 24.8 197.9 18.5% 0.0% 0.0% 0.0% 11.63sec 302142 298.69sec
Harmony Harmony arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.26sec 0 298.69sec
Harmony Harmony arcane_orb_bolt 153640 292606 980 12.76 3861 7873 63.5 63.5 18.7% 0.0% 0.0% 0.0% 24.26sec 292606 298.69sec
Harmony Harmony arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.55sec 0 298.69sec
Harmony Harmony berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 252.91sec 0 298.69sec
Harmony Harmony conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Harmony Harmony deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.68sec 0 298.69sec
Harmony Harmony deathly_eruption 322256 20156 67 2.97 1133 2269 14.8 14.8 20.3% 0.0% 0.0% 0.0% 1.68sec 20156 298.69sec
Harmony Harmony eternal_insight 342314 11276 38 4.14 462 924 20.6 20.6 18.5% 0.0% 0.0% 0.0% 14.02sec 11276 298.69sec
Harmony Harmony evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 170.08sec 0 298.69sec
Harmony Harmony flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Harmony Harmony food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Harmony Harmony frostbolt 116 1194 4 0.20 1024 2047 0.0 1.0 16.6% 0.0% 0.0% 0.0% 0.00sec 1194 298.69sec
Harmony Harmony mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Harmony Harmony_mirror_image frostbolt 59638 4551 114 139.50 41 82 93.0 93.0 20.1% 0.0% 0.0% 0.0% 1.25sec 4551 40.00sec
Harmony Harmony potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
Harmony Harmony rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.13sec 0 298.69sec
Harmony Harmony touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.70sec 0 298.69sec
Harmony Harmony touch_of_the_magi_explosion 210833 214755 719 6.22 6942 0 6.2 30.9 0.0% 0.0% 0.0% 0.0% 51.55sec 214755 298.69sec
Harmony Harmony use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.41sec 0 298.69sec
SiphonStorm SiphonStorm arcane_barrage 44425 1675826 5611 58.38 4831 9865 58.2 290.6 18.6% 0.0% 0.0% 0.0% 5.15sec 1675826 298.69sec
SiphonStorm SiphonStorm arcane_blast 30451 59 0 0.01 1637 2208 0.0 0.0 33.3% 0.0% 0.0% 0.0% 1.59sec 59 298.69sec
SiphonStorm SiphonStorm arcane_explosion 1449 1830319 6128 158.61 1942 3980 157.9 789.6 18.5% 0.0% 0.0% 0.0% 1.87sec 1830319 298.69sec
SiphonStorm SiphonStorm arcane_orb 153626 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 22.76sec 0 298.69sec
SiphonStorm SiphonStorm arcane_orb_bolt 153640 345741 1158 13.56 4260 8762 67.5 67.5 19.2% 0.0% 0.0% 0.0% 22.76sec 345741 298.69sec
SiphonStorm SiphonStorm arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.94sec 0 298.69sec
SiphonStorm SiphonStorm berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 255.89sec 0 298.69sec
SiphonStorm SiphonStorm conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
SiphonStorm SiphonStorm deathly_fixation 322253 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 1.73sec 0 298.69sec
SiphonStorm SiphonStorm deathly_eruption 322256 20065 67 2.93 1137 2276 14.6 14.6 21.1% 0.0% 0.0% 0.0% 1.73sec 20065 298.69sec
SiphonStorm SiphonStorm eternal_insight 342314 11186 37 4.09 464 928 20.4 20.4 18.4% 0.0% 0.0% 0.0% 14.46sec 11186 298.69sec
SiphonStorm SiphonStorm evocation 12051 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 136.29sec 0 298.69sec
SiphonStorm SiphonStorm flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
SiphonStorm SiphonStorm food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
SiphonStorm SiphonStorm mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
SiphonStorm SiphonStorm_mirror_image frostbolt 59638 4964 124 139.50 44 89 93.0 93.0 20.0% 0.0% 0.0% 0.0% 1.25sec 4964 40.00sec
SiphonStorm SiphonStorm potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
SiphonStorm SiphonStorm rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.94sec 0 298.69sec
SiphonStorm SiphonStorm touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.72sec 0 298.69sec
SiphonStorm SiphonStorm touch_of_the_magi_explosion 210833 212778 712 6.20 6899 0 6.2 30.9 0.0% 0.0% 0.0% 0.0% 51.66sec 212778 298.69sec
SiphonStorm SiphonStorm use_mana_gem 5405 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 129.44sec 0 298.69sec
arcane arcane arcane_barrage 44425 1669449 5589 60.31 4661 9518 60.1 300.2 18.5% 0.0% 0.0% 0.0% 4.98sec 1669449 298.69sec
arcane arcane arcane_explosion 1449 1903030 6371 166.67 1921 3924 165.9 829.7 18.6% 0.0% 0.0% 0.0% 1.78sec 1903030 298.69sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.36sec 0 298.69sec
arcane arcane arcane_orb_bolt 153640 322062 1078 13.26 4087 8405 66.0 66.0 18.4% 0.0% 0.0% 0.0% 23.36sec 322062 298.69sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.93sec 0 298.69sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.75sec 0 298.69sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 18.5 0.0 0.0% 0.0% 0.0% 0.0% 1.35sec 0 298.69sec
arcane arcane deathly_eruption 322256 25487 85 3.72 1138 2277 18.5 18.5 20.9% 0.0% 0.0% 0.0% 1.35sec 25487 298.69sec
arcane arcane eternal_insight 342314 11656 39 4.25 465 929 21.1 21.1 18.8% 0.0% 0.0% 0.0% 13.76sec 11656 298.69sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 210.55sec 0 298.69sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
arcane arcane frostbolt 116 1175 4 0.20 1024 2047 0.0 1.0 14.7% 0.0% 0.0% 0.0% 0.00sec 1175 298.69sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
arcane arcane_mirror_image frostbolt 59638 5704 143 175.50 41 82 117.0 117.0 20.0% 0.0% 0.0% 0.0% 0.99sec 5704 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.41sec 0 298.69sec
arcane arcane time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.12sec 0 298.69sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.62sec 0 298.69sec
arcane arcane touch_of_the_magi_explosion 210833 183599 615 6.23 5928 0 6.2 31.0 0.0% 0.0% 0.0% 0.0% 51.54sec 183599 298.69sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 125.09sec 0 298.69sec
disciplinary_command disciplinary_command arcane_barrage 44425 1575583 5275 56.10 4622 10177 55.9 279.3 18.4% 0.0% 0.0% 0.0% 5.34sec 1575583 298.69sec
disciplinary_command disciplinary_command arcane_explosion 1449 1718655 5754 152.79 1855 4021 152.1 760.6 18.7% 0.0% 0.0% 0.0% 1.93sec 1718655 298.69sec
disciplinary_command disciplinary_command arcane_orb 153626 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.65sec 0 298.69sec
disciplinary_command disciplinary_command arcane_orb_bolt 153640 326156 1092 13.05 4090 9184 65.0 65.0 18.3% 0.0% 0.0% 0.0% 23.66sec 326156 298.69sec
disciplinary_command disciplinary_command arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 130.97sec 0 298.69sec
disciplinary_command disciplinary_command berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 262.15sec 0 298.69sec
disciplinary_command disciplinary_command conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
disciplinary_command disciplinary_command deathly_fixation 322253 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 1.70sec 0 298.69sec
disciplinary_command disciplinary_command deathly_eruption 322256 21430 72 3.01 1137 2513 15.0 15.0 21.2% 0.0% 0.0% 0.0% 1.70sec 21430 298.69sec
disciplinary_command disciplinary_command eternal_insight 342314 11566 39 4.16 464 979 20.7 20.7 18.3% 0.0% 0.0% 0.0% 13.91sec 11566 298.69sec
disciplinary_command disciplinary_command evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 176.80sec 0 298.69sec
disciplinary_command disciplinary_command fire_blast 319836 10198 34 1.21 1455 2908 6.0 6.0 16.7% 0.0% 0.0% 0.0% 51.39sec 10198 298.69sec
disciplinary_command disciplinary_command flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
disciplinary_command disciplinary_command food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
disciplinary_command disciplinary_command frostbolt 116 7602 25 1.21 1032 2376 5.0 6.0 17.4% 0.0% 0.0% 0.0% 51.39sec 7602 298.69sec
disciplinary_command disciplinary_command mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
disciplinary_command disciplinary_command_mirror_image frostbolt 59638 4535 113 139.50 41 82 93.0 93.0 19.6% 0.0% 0.0% 0.0% 1.25sec 4535 40.00sec
disciplinary_command disciplinary_command potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
disciplinary_command disciplinary_command rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.02sec 0 298.69sec
disciplinary_command disciplinary_command touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 54.09sec 0 298.69sec
disciplinary_command disciplinary_command touch_of_the_magi_explosion 210833 204046 683 5.98 6853 0 6.0 29.8 0.0% 0.0% 0.0% 0.0% 53.97sec 204046 298.69sec
disciplinary_command disciplinary_command use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.71sec 0 298.69sec
expanded_potential expanded_potential arcane_barrage 44425 1611631 5396 58.87 4613 9384 58.7 293.1 18.6% 0.0% 0.0% 0.0% 5.10sec 1611631 298.69sec
expanded_potential expanded_potential arcane_explosion 1449 1767507 5918 160.89 1848 3780 160.2 800.9 18.6% 0.0% 0.0% 0.0% 1.84sec 1767507 298.69sec
expanded_potential expanded_potential arcane_orb 153626 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 22.65sec 0 298.69sec
expanded_potential expanded_potential arcane_orb_bolt 153640 335036 1122 13.63 4123 8412 67.9 67.9 18.9% 0.0% 0.0% 0.0% 22.64sec 335036 298.69sec
expanded_potential expanded_potential arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 124.82sec 0 298.69sec
expanded_potential expanded_potential berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 249.59sec 0 298.69sec
expanded_potential expanded_potential conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
expanded_potential expanded_potential deathly_fixation 322253 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 1.69sec 0 298.69sec
expanded_potential expanded_potential deathly_eruption 322256 20526 69 2.99 1137 2274 14.9 14.9 21.4% 0.0% 0.0% 0.0% 1.69sec 20526 298.69sec
expanded_potential expanded_potential eternal_insight 342314 11352 38 4.12 464 928 20.5 20.5 19.1% 0.0% 0.0% 0.0% 14.05sec 11352 298.69sec
expanded_potential expanded_potential evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 183.81sec 0 298.69sec
expanded_potential expanded_potential flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
expanded_potential expanded_potential food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
expanded_potential expanded_potential frostbolt 116 1196 4 0.20 1024 2047 0.0 1.0 16.8% 0.0% 0.0% 0.0% 0.00sec 1196 298.69sec
expanded_potential expanded_potential mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
expanded_potential expanded_potential_mirror_image frostbolt 59638 4522 113 139.50 40 82 93.0 93.0 19.9% 0.0% 0.0% 0.0% 1.25sec 4522 40.00sec
expanded_potential expanded_potential potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
expanded_potential expanded_potential rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.06sec 0 298.69sec
expanded_potential expanded_potential touch_of_the_magi 321507 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 50.81sec 0 298.69sec
expanded_potential expanded_potential touch_of_the_magi_explosion 210833 203043 680 6.31 6466 0 6.3 31.4 0.0% 0.0% 0.0% 0.0% 50.67sec 203043 298.69sec
expanded_potential expanded_potential use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.42sec 0 298.69sec
no_lego no_lego arcane_barrage 44425 1496184 5009 60.24 4259 8721 60.1 299.9 16.4% 0.0% 0.0% 0.0% 4.99sec 1496184 298.69sec
no_lego no_lego arcane_blast 30451 2 0 0.00 2128 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 2 298.69sec
no_lego no_lego arcane_explosion 1449 1705298 5709 166.55 1753 3594 165.8 829.1 16.5% 0.0% 0.0% 0.0% 1.78sec 1705298 298.69sec
no_lego no_lego arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.35sec 0 298.69sec
no_lego no_lego arcane_orb_bolt 153640 287415 962 13.24 3714 7612 65.9 65.9 16.6% 0.0% 0.0% 0.0% 23.35sec 287415 298.69sec
no_lego no_lego arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.81sec 0 298.69sec
no_lego no_lego berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.60sec 0 298.69sec
no_lego no_lego conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
no_lego no_lego deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 1.35sec 0 298.69sec
no_lego no_lego deathly_eruption 322256 25142 84 3.74 1136 2275 18.6 18.6 18.8% 0.0% 0.0% 0.0% 1.35sec 25142 298.69sec
no_lego no_lego eternal_insight 342314 11546 39 4.27 464 929 21.3 21.3 16.8% 0.0% 0.0% 0.0% 13.31sec 11546 298.69sec
no_lego no_lego evocation 12051 0 0 0.00 0 0 1.3 0.0 0.0% 0.0% 0.0% 0.0% 230.73sec 0 298.69sec
no_lego no_lego flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
no_lego no_lego food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
no_lego no_lego frostbolt 116 1070 4 0.20 938 1876 0.0 1.0 14.1% 0.0% 0.0% 0.0% 0.00sec 1070 298.69sec
no_lego no_lego mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
no_lego no_lego_mirror_image frostbolt 59638 5145 129 175.50 37 75 117.0 117.0 17.8% 0.0% 0.0% 0.0% 0.99sec 5145 40.00sec
no_lego no_lego potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
no_lego no_lego rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.34sec 0 298.69sec
no_lego no_lego time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.03sec 0 298.69sec
no_lego no_lego touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.58sec 0 298.69sec
no_lego no_lego touch_of_the_magi_explosion 210833 164091 549 6.23 5295 0 6.2 31.0 0.0% 0.0% 0.0% 0.0% 51.46sec 164091 298.69sec
no_lego no_lego use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.64sec 0 298.69sec
temporal_warp temporal_warp arcane_barrage 44425 1670246 5592 60.30 4663 9482 60.1 300.2 18.7% 0.0% 0.0% 0.0% 4.98sec 1670246 298.69sec
temporal_warp temporal_warp arcane_explosion 1449 1904246 6375 166.67 1920 3931 165.9 829.7 18.7% 0.0% 0.0% 0.0% 1.78sec 1904246 298.69sec
temporal_warp temporal_warp arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.34sec 0 298.69sec
temporal_warp temporal_warp arcane_orb_bolt 153640 322242 1079 13.26 4085 8370 66.0 66.0 18.6% 0.0% 0.0% 0.0% 23.34sec 322242 298.69sec
temporal_warp temporal_warp arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.05sec 0 298.69sec
temporal_warp temporal_warp berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.20sec 0 298.69sec
temporal_warp temporal_warp conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
temporal_warp temporal_warp deathly_fixation 322253 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 1.35sec 0 298.69sec
temporal_warp temporal_warp deathly_eruption 322256 25359 85 3.71 1137 2276 18.4 18.4 20.8% 0.0% 0.0% 0.0% 1.35sec 25359 298.69sec
temporal_warp temporal_warp eternal_insight 342314 11744 39 4.29 464 928 21.3 21.3 18.5% 0.0% 0.0% 0.0% 13.82sec 11744 298.69sec
temporal_warp temporal_warp evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 230.66sec 0 298.69sec
temporal_warp temporal_warp flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
temporal_warp temporal_warp food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
temporal_warp temporal_warp frostbolt 116 1170 4 0.20 1024 2047 0.0 1.0 14.3% 0.0% 0.0% 0.0% 0.00sec 1170 298.69sec
temporal_warp temporal_warp mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
temporal_warp temporal_warp_mirror_image frostbolt 59638 5696 142 175.50 41 81 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5696 40.00sec
temporal_warp temporal_warp potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.69sec
temporal_warp temporal_warp rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.41sec 0 298.69sec
temporal_warp temporal_warp time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.05sec 0 298.69sec
temporal_warp temporal_warp touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.65sec 0 298.69sec
temporal_warp temporal_warp touch_of_the_magi_explosion 210833 182835 612 6.23 5901 0 6.2 31.0 0.0% 0.0% 0.0% 0.0% 51.56sec 182835 298.69sec
temporal_warp temporal_warp use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 124.49sec 0 298.69sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
30120.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 48.0sec 10.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 140.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:10.66%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 26.6sec 7.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 47.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.75%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 31.0sec 10.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 41.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.26%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.8s / 47.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.73%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 53.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.33%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 31.3sec 10.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.6s / 41.6s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.61%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.4sec 13.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.0s / 50.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.70%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 38.0sec 12.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.9s / 52.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.91%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 19.5sec 6.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.4s / 34.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.61%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.7sec 3.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.46%
Sinful Revelation 1.1 0.0 98.9sec 94.5sec 10.0sec 3.80% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.2s / 312.7s
  • trigger_min/max:2.5s / 312.7s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.6s

Stack Uptimes

  • sinful_revelation_1:3.80%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 96.8sec 92.7sec 9.9sec 4.04% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.9s / 257.2s
  • trigger_min/max:1.4s / 257.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.3s

Stack Uptimes

  • sinful_revelation_1:4.04%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.4 0.8 54.7sec 44.5sec 10.6sec 15.47% 0.00% 0.8 (0.8) 4.2

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 327.4s
  • trigger_min/max:0.2s / 327.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 46.0s

Stack Uptimes

  • sinful_revelation_1:15.47%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 93.7sec 90.4sec 9.9sec 4.05% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 317.4s
  • trigger_min/max:1.4s / 317.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.0s

Stack Uptimes

  • sinful_revelation_1:4.05%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.9 0.1 85.9sec 77.1sec 10.0sec 6.33% 0.00% 0.1 (0.1) 1.8

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 331.4s
  • trigger_min/max:1.4s / 331.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.6s

Stack Uptimes

  • sinful_revelation_1:6.34%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 93.7sec 89.0sec 10.0sec 4.01% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.2s / 321.0s
  • trigger_min/max:1.3s / 321.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.9s

Stack Uptimes

  • sinful_revelation_1:4.02%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 96.6sec 92.9sec 9.9sec 3.84% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.9s / 319.2s
  • trigger_min/max:1.4s / 319.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 13.3s

Stack Uptimes

  • sinful_revelation_1:3.85%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 94.6sec 91.7sec 9.9sec 3.88% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.2s / 311.1s
  • trigger_min/max:1.3s / 311.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.9s

Stack Uptimes

  • sinful_revelation_1:3.88%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.50% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.4s
  • trigger_min/max:47.2s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.50%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.3 0.0 50.6sec 50.8sec 7.9sec 16.72% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 64.9s
  • trigger_min/max:46.7s / 64.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.72%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.6sec 51.7sec 7.9sec 16.46% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 71.5s
  • trigger_min/max:46.3s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.46%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.6sec 51.7sec 7.9sec 16.44% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 62.0s
  • trigger_min/max:46.3s / 62.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.44%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 53.8sec 53.9sec 7.9sec 15.84% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.2s / 67.9s
  • trigger_min/max:49.6s / 67.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.84%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.49% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.6s
  • trigger_min/max:47.2s / 67.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.49%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.3 0.0 50.7sec 50.8sec 7.9sec 16.72% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 68.7s
  • trigger_min/max:46.7s / 68.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.72%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.4sec 51.5sec 7.9sec 16.50% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.4s
  • trigger_min/max:47.2s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.50%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Fluffy_Pillow Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1017
Mean 32029.25
Minimum 30071.63
Maximum 34365.69
Spread ( max - min ) 4294.06
Range [ ( max - min ) / 2 * 100% ] 6.70%
Standard Deviation 750.3719
5th Percentile 30885.22
95th Percentile 33302.35
( 95th Percentile - 5th Percentile ) 2417.13
Mean Distribution
Standard Deviation 23.5297
95.00% Confidence Interval ( 31983.13 - 32075.36 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2109
0.1 Scale Factor Error with Delta=300 4807
0.05 Scale Factor Error with Delta=300 19227
0.01 Scale Factor Error with Delta=300 480659
HPS
Fluffy_Pillow Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 120
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 9669541 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
17847.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 49.6sec 11.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 141.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:11.15%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 27.2sec 8.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 46.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.12%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 32.0sec 10.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 41.3s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.63%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 47.6s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.72%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 31.8sec 10.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 49.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.78%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 30.9sec 10.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.9s / 41.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.51%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.9sec 13.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.0s / 49.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.55%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 37.3sec 12.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.8s / 51.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.65%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 19.0sec 6.44% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.2s / 32.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.44%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 3.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.52%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1151
death count pct 111.42
avg death time 291.63
min death time 240.17
max death time 359.97
dmg taken 5672208.37

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy2 Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1017
Mean 19006.76
Minimum 18093.83
Maximum 20055.87
Spread ( max - min ) 1962.04
Range [ ( max - min ) / 2 * 100% ] 5.16%
Standard Deviation 395.8639
5th Percentile 18399.93
95th Percentile 19690.58
( 95th Percentile - 5th Percentile ) 1290.65
Mean Distribution
Standard Deviation 12.4132
95.00% Confidence Interval ( 18982.44 - 19031.09 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1667
0.1 Scale Factor Error with Delta=300 1338
0.05 Scale Factor Error with Delta=300 5352
0.01 Scale Factor Error with Delta=300 133776
HPS
enemy2 Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 120
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 6340020 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
17900.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 48.7sec 10.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 141.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:10.55%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 27.0sec 7.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.98%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 31.7sec 10.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 42.5s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.48%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.8sec 12.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.6s / 47.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.82%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 32.9sec 11.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.7s / 50.7s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.15%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 30.7sec 10.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.8s / 40.7s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.41%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.5sec 13.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.0s / 49.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.74%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.8s / 51.2s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.78%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 19.4sec 6.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 34.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.60%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 3.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.55%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1151
death count pct 111.42
avg death time 291.63
min death time 240.17
max death time 359.97
dmg taken 5671679.26

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy3 Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1017
Mean 19004.68
Minimum 17929.86
Maximum 20108.24
Spread ( max - min ) 2178.38
Range [ ( max - min ) / 2 * 100% ] 5.73%
Standard Deviation 380.5199
5th Percentile 18432.82
95th Percentile 19650.67
( 95th Percentile - 5th Percentile ) 1217.86
Mean Distribution
Standard Deviation 11.9321
95.00% Confidence Interval ( 18981.30 - 19028.07 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1541
0.1 Scale Factor Error with Delta=300 1237
0.05 Scale Factor Error with Delta=300 4945
0.01 Scale Factor Error with Delta=300 123606
HPS
enemy3 Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 120
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 6201710 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
17849.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 49.2sec 10.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 140.3s

Stack Uptimes

  • Health Decade (0 - 10)_1:10.98%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 27.7sec 8.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 46.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.11%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 31.8sec 10.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.1s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.51%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.7s / 47.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.69%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 32.1sec 10.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.6s / 50.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.87%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 31.2sec 10.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.0s / 41.2s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.58%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.1sec 13.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.8s / 49.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.61%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.9s / 51.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.62%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 19.2sec 6.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 32.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.52%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 3.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.1s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.54%
Sinful Revelation 0.0 0.0 0.0sec 0.0sec 10.0sec 0.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s

Stack Uptimes

  • sinful_revelation_1:0.07%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1151
death count pct 111.42
avg death time 291.63
min death time 240.17
max death time 359.97
dmg taken 5666783.15

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy4 Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 1017
Mean 18988.89
Minimum 18060.61
Maximum 20082.49
Spread ( max - min ) 2021.87
Range [ ( max - min ) / 2 * 100% ] 5.32%
Standard Deviation 383.9330
5th Percentile 18412.02
95th Percentile 19627.26
( 95th Percentile - 5th Percentile ) 1215.24
Mean Distribution
Standard Deviation 12.0391
95.00% Confidence Interval ( 18965.30 - 19012.49 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1571
0.1 Scale Factor Error with Delta=300 1259
0.05 Scale Factor Error with Delta=300 5034
0.01 Scale Factor Error with Delta=300 125833
HPS
enemy4 Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 120
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 5559411 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
18980.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 51.5sec 11.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 145.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:11.39%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.1sec 8.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.8s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.25%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 32.8sec 10.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 43.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.84%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.9sec 12.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.9s / 48.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.85%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 32.7sec 11.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.6s / 51.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.09%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.2s / 43.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.27%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 41.6sec 14.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:31.8s / 52.1s

Stack Uptimes

  • Health Decade (60 - 70)_1:14.11%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 34.4sec 11.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.7s / 53.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:11.69%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.2sec 5.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.0s / 27.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.15%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.4sec 3.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.9s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.38%
Sinful Revelation 10.0 5.4 29.2sec 18.4sec 12.4sec 41.35% 0.00% 5.4 (5.4) 9.5

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 119.8s
  • trigger_min/max:0.8s / 112.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.9s

Stack Uptimes

  • sinful_revelation_1:41.35%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.1 5.3 28.8sec 18.3sec 12.3sec 41.33% 0.00% 5.3 (5.3) 9.6

Buff Details

  • buff initial source:Bombardment
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 143.8s
  • trigger_min/max:0.9s / 129.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.2s

Stack Uptimes

  • sinful_revelation_1:41.33%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.3 3.1 34.0sec 24.1sec 11.6sec 32.44% 0.00% 3.1 (3.1) 8.0

Buff Details

  • buff initial source:Harmony
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 181.4s
  • trigger_min/max:0.9s / 171.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.6s

Stack Uptimes

  • sinful_revelation_1:32.44%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.2 29.0sec 18.5sec 12.2sec 40.92% 0.00% 5.2 (5.2) 9.6

Buff Details

  • buff initial source:SiphonStorm
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 127.9s
  • trigger_min/max:0.9s / 127.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.0s

Stack Uptimes

  • sinful_revelation_1:40.92%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.7 5.0 29.9sec 19.2sec 12.2sec 39.53% 0.00% 5.0 (5.0) 9.3

Buff Details

  • buff initial source:disciplinary_command
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 143.4s
  • trigger_min/max:0.9s / 143.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.7s

Stack Uptimes

  • sinful_revelation_1:39.53%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.3 29.0sec 18.4sec 12.4sec 41.26% 0.00% 5.3 (5.3) 9.6

Buff Details

  • buff initial source:temporal_warp
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 156.4s
  • trigger_min/max:0.8s / 156.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.1s

Stack Uptimes

  • sinful_revelation_1:41.26%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.2 29.0sec 18.6sec 12.3sec 41.09% 0.00% 5.2 (5.2) 9.6

Buff Details

  • buff initial source:expanded_potential
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 107.6s
  • trigger_min/max:0.9s / 107.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.9s

Stack Uptimes

  • sinful_revelation_1:41.09%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.2 29.0sec 18.5sec 12.3sec 40.96% 0.00% 5.2 (5.2) 9.5

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 108.3s
  • trigger_min/max:0.8s / 108.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 58.1s

Stack Uptimes

  • sinful_revelation_1:40.96%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1151
death count pct 111.42
avg death time 291.63
min death time 240.17
max death time 359.97
dmg taken 6034147.03

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 1017
Mean 298.69
Minimum 240.17
Maximum 359.97
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy5 Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 1017
Mean 20225.73
Minimum 19144.34
Maximum 21431.45
Spread ( max - min ) 2287.11
Range [ ( max - min ) / 2 * 100% ] 5.65%
Standard Deviation 419.1478
5th Percentile 19563.38
95th Percentile 20933.28
( 95th Percentile - 5th Percentile ) 1369.90
Mean Distribution
Standard Deviation 13.1434
95.00% Confidence Interval ( 20199.97 - 20251.49 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1650
0.1 Scale Factor Error with Delta=300 1500
0.05 Scale Factor Error with Delta=300 5999
0.01 Scale Factor Error with Delta=300 149975
HPS
enemy5 Healing Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 1017
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 120
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 6141584 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.